KEGG   Nasonia vitripennis (jewel wasp): 100114726Help
Entry
100114726         CDS       T01081                                 

Definition
acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100114726
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100114726
   00620 Pyruvate metabolism
    100114726
   00640 Propanoate metabolism
    100114726
Enzymes [BR:nvi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     100114726
Lipid biosynthesis proteins [BR:nvi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   100114726
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
1
AA seq 681 aa AA seqDB search
MADRIYQPNPELARAAHCKSMEQYKRMHERSIKHPAQFWGEIAKEFYWETHTTEDKFFSY
NFDLNAGDIYIKWMEGASTNLSFNLLDKNVKNGKGDQVAFYWEGNDPDDYSRLTYRKLLE
ETCRFANVLKSKGVQKGDRVAIYMPMILELPIAMLACTRIGAVHSVVFAGYSADSLAERM
LDSKAKVLVTADGVWRGEKLLLLKTICDDALDKVKKHGHQVESCIVVSHLRRLSAPQGKN
ETPHANGATNGNSNGDSQQVPWDDDRDAWWHDEMEDAEASCYPVWMNAEDPLFILYTSGS
TGKPKGVQHTTAGYLIYAATTFKYVFDYHPGDVYWCTADIGWITGHTYVVYGPLANGATS
VLFEGTPFYPTNDRYWSVVDKYKVNQFYTAPTAIRSLMKFGDDHVKKHDLSTLKVLGSVG
EPINSEAWLWFYNLVGHGKCSIADTFWQTETGGHVITPLPGATPMKPGSASFPFFGVQPE
LLDEDGHVIEGEGEGYLVFRRPWPGMMRTLYGNHERFQSTYFDRFHGFYCTGDGARRDKD
GYLWVTGRIDDMLNVSGHLMSTAEVESVLAEHSSVAEAAVVSKPHPVKGQCLYCFVTPNE
GKPFDKKLQDELKKKVRERIGPFAQPDVIQHAPGLPKTRSGKIMRRVLRKIAIGDKNVGD
VSTLADEGVVDLLFSLRPQQV
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaggatataccagccgaatcctgagctcgccagggcggctcactgcaagagc
atggagcagtacaagcgaatgcacgagaggtcgataaagcatccggcacaattttggggc
gaaatagccaaggaattctactgggagacgcacacgactgaggacaaattcttctcttac
aattttgacctgaatgcgggtgacatctacatcaagtggatggaaggagcctctacgaat
ttgagcttcaatctgctcgacaagaacgtcaagaacggaaagggcgatcaagtggccttt
tactgggagggcaatgacccggacgactactctcgtctcacttaccggaagctcctggag
gagacctgtcgtttcgccaacgtgctcaagtcgaaaggcgtgcagaagggcgaccgcgtg
gccatctacatgcccatgatcctcgagctgcccatagcgatgctcgcctgcacgaggatc
ggcgcagttcacagcgtcgtgttcgcaggttactcggcggactcgctggccgagcgcatg
ctggactcgaaggccaaggtcctggtcacggctgacggggtctggcgcggggagaagctt
ctgctgctcaagaccatctgcgacgacgccctcgacaaggttaagaagcacggacaccag
gtcgagagctgcatcgtcgtgtcgcatctcaggcggctcagcgctccccagggcaagaac
gaaacccctcacgcgaatggcgcgacgaacggaaattcgaacggcgactcgcagcaggtg
ccctgggacgacgacagggacgcttggtggcacgacgagatggaggacgccgaggcgagt
tgctatcccgtctggatgaacgccgaagatccgctctttattctgtacacgagcggctca
acgggaaagcccaagggtgtccagcacacgacggccggctacttgatatacgccgcgacg
actttcaaatacgtcttcgactatcatcccggggacgtgtactggtgcactgctgacatc
ggctggatcaccgggcacacctacgtcgtttacggacccctcgccaatggagccacgtcc
gtcttgttcgagggcacaccgttctatccgacgaacgacaggtactggtctgtcgtcgac
aagtacaaagtcaatcagttctacacggcgccaaccgcaattcggtcactcatgaaattc
ggcgacgaccacgtgaagaagcacgatctgagcacgctcaaggttctcggctcggtgggc
gagccgatcaactcggaagcttggctctggttctacaacctcgtgggtcacggtaagtgc
agcatagccgacacgttctggcagaccgagaccggcggtcacgtcatcacaccgctgccc
ggcgcgacgcccatgaagcctggctcagccagctttccgttcttcggcgtacaacccgag
ctgctggacgaggacggccacgtgatcgagggcgaaggcgagggatatctcgtgttccgc
aggccctggcccggcatgatgcgcacgctctacggcaaccacgagcgattccagagcacg
tacttcgacaggtttcacggattctactgcacgggcgacggcgctcgaagggataaagac
ggctatctctgggtcaccggccgtatcgacgacatgttgaacgtgtccggtcacctcatg
tccaccgccgaggtcgagagtgtgctggcggaacactcttccgtcgccgaagccgccgtc
gtcagtaaacctcacccggtcaagggccagtgtctctactgctttgttacacccaacgag
ggcaagcccttcgataagaaactccaggatgagctcaagaaaaaggttcgcgaaagaatc
ggtccgttcgcccagccggacgtgatccagcacgctccaggtctgccgaaaactcggtcc
ggcaagataatgcgacgggtgttgcgaaagatcgcgatcggcgacaagaacgtcggcgac
gtctcgacgctggctgacgaaggtgtcgtcgaccttctcttctctctgaggccgcaacaa
gtctaa

DBGET integrated database retrieval system