KEGG   Nasonia vitripennis (jewel wasp): 100114801Help
Entry
100114801         CDS       T01081                                 

Definition
uroporphyrinogen-III synthase-like
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:nvi00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
4
AA seq 259 aa AA seqDB search
MSINKIKVLLCTGVSSETDNNENQYKKCLTEHGFECEILQVLHFEFINLDDLRNTLLDSE
SYNGLILTSPRAAAAIAMTKMQNPFSLEPWLEKTTFCIGQATEFVAKEQVGLTNIFGSDS
GNAKNLANFIVHTMKEKCKKPLLLPCSDIARDTIPQILLNNKIEVKKIVVYKTKAHHFLA
EALNEALNQSPHVLVFYSPSIVDNMLNALSNNKTIFENFKIIAIGPVTEEALENAGIKVD
GVAEKPEPTSLTEVIQKII
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtctattaataaaataaaagttttattatgtaccggagtttcaagtgagacagataac
aatgaaaatcagtataaaaaatgtcttacagaacatggctttgaatgtgaaatattgcaa
gtgctacattttgaatttattaatctagatgatttacgcaatactttgcttgattcggaa
tcttataatggtttaatactaacaagtccaagagcagctgcagctatagctatgacaaaa
atgcaaaatccattttccttggaaccatggctagaaaaaacaacattttgtattggtcag
gctacagaatttgttgcaaaggaacaagttgggttaactaatatatttggttctgattct
gggaatgccaagaacttagctaatttcattgtacacactatgaaagaaaaatgtaaaaag
ccactactacttccatgcagtgatattgcaagagatacaataccacaaattttattaaac
aataaaatagaagtaaaaaaaattgttgtatataaaacaaaagctcatcattttttagca
gaagcattaaatgaagctttaaaccaatcaccacatgttttagtattctatagtccatca
attgtagataatatgttgaatgccttatctaataataagactatatttgaaaatttcaaa
attattgcaattggtcctgttactgaagaagctttagaaaatgcaggaatcaaagttgat
ggagtagctgaaaaaccagaacctacatccttgactgaagtcatacagaaaatcatttaa

DBGET integrated database retrieval system