KEGG   Nasonia vitripennis (jewel wasp): 100114802Help
Entry
100114802         CDS       T01081                                 

Definition
uncharacterized LOC100114802
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100114802
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
4
AA seq 1090 aa AA seqDB search
MTTLHDAIPDKPAERKSAGEAALPSSRPQSDSDHNLIRFSRDFSEAASNSSGPSSLVPES
LSSASSFQSLASTLSSKSSSGICADSAPGSPDKVNSGNGFDHSYVNVDIPDLDDLISACA
NINLNNATVLGGLLPGENRAGDESPDSSGGDLSQDQTFASAADDTLADETQVLVEETIQT
FKTCPPLEVTQVTSAETHVFKAPISVDEQSSVIPYLSFEESVLRKHQEFVDDGAEFKSAL
TSFQATQSITVSSTVDTRRGSYSPTPCEEIDVAQVAKITCKSPKDLDIAQESLIVVVDEV
VEKKEQIVEQDFILGTPDASFEEVQAFNSTIILNTDLASEEPTVLSNIKNEVVDKEEKKP
VISLDEVPVGVKTKGSEIVQETIPNILNHTHDNAQDTGILNKTQDIVQDANVLNNTQDIV
QNTNILNQTQDIVQEKTILNKTQDIVQEESNLIKTELIAQEVNKSVNKNEVIIRQISDLS
KTESVQSKTQHFTKEDHFVEKKEILKHNIGSYNEIDERPIKPQIQEAQSPKIIESNEENT
CRTPQKLEETFPKPEAKSPKQLETFANEEAQNLNLINTEAVASTPLPVKNLNKAKTPKTP
KTKSALFTNEPKSPKPPAQTSKTPIKSEEIKEEKNKLNFDQTLAINKSLEQSSFSATELI
TNLETTSDVLHENLCIAPIQEPEYEAFKPIQQSTTLPFPDFKKLQEAALSVAKEIDESLE
KIEETEQFVSATTELFGDPSALDFLTQVGSQHPTKRGERYDSLYMKFDPLAQRLSMLPQK
NLPTAPSVDEEEEKEKEAKVNKPSSEMGTPKKNPALAAIDRLLFYSPCPPSATESAVAEA
KQKKEEAEKQESPVVPFVDEKMAKELELVRTTVLQLEAELEKQKQEHREQLEKQKAAYEE
KVTHMQTKFTQMQSQLTQEVKCKGQMTVVVEEYEKSISRLIAEREKDRTSFEVEKAKLQE
ELQVANQHLSNTEAAFSDVHSKYERLKNVVSAYKSNETVLKESIAENQETIKTLENRYEQ
LKSHAMAQLEKANLELSAIRKQNEAETVKLKALVRKAELKSKSLAETVEQKIKENKELTQ
IIDEMIARVD
NT seq 3273 nt NT seq  +upstreamnt  +downstreamnt
atgacaactctgcacgatgccattccggacaagccggccgagcgcaagagcgccggcgag
gcagccctaccatccagccgcccgcaatccgattcggaccacaatctgatccgtttctct
cgggacttctcagaagcagcatcgaacagcagtgggccgagcagtctcgttccggagagt
ctctcatcagcctcgagctttcagagtctcgcctcgacactcagttccaagtccagcagt
ggcatctgcgccgattcggctcctggtagtccggacaaggtcaactccggcaacggattc
gatcactcctacgtcaacgtcgatatccctgacttggacgatcttatctctgcctgtgcg
aacatcaacttgaacaacgctactgtgctcggaggattgctgcctggcgagaatagagct
ggtgatgaatcgccggatagcagtggaggtgatctgagccaggatcagacgtttgcttca
gcggcggatgatactctcgccgatgagacgcaggttctcgtcgaggagactattcagact
ttcaagacctgtcctcctctagaggtaactcaggtcacatcggccgaaacccacgtcttc
aaggctcccatctcggtcgacgagcagtcatctgtgatcccgtacctgtcgttcgaggaa
agcgttcttcgcaagcaccaggagttcgtggacgacggggccgagtttaagagcgcgctc
acctctttccaagccactcagtccataactgtctcttccactgttgacactcgacgtggc
agttacagtccgacgccttgcgaagaaatcgacgtagctcaggtcgccaagatcacgtgc
aagagtccaaaggatcttgatattgcacaggagagcttgatcgttgttgttgacgaggtc
gtcgagaagaaagaacaaattgtagaacaagatttcatacttggcacacctgatgctagc
ttcgaggaagtccaggccttcaattccactattatactgaatacagatctggcatctgag
gagccaacggtattatctaatatcaagaacgaagttgtagataaagaagagaaaaaacca
gtaatttctcttgacgaagttccagttggagttaagacaaaagggagtgaaattgttcag
gaaacaattcctaatattcttaatcatacacacgataatgcacaagatactggcatttta
aacaagacacaggatattgtacaagatgctaacgttttaaataacacacaagatattgta
caaaatactaatattttaaatcagacccaagatattgtacaggaaaaaaccattctaaat
aaaactcaagacatcgttcaagaggaatcgaacctaattaagacagaacttattgcacag
gaggtaaacaaatctgtgaataaaaacgaagttattatacggcagataagcgatcttagt
aagacagaaagtgtacaaagtaaaacacaacattttactaaggaagatcattttgttgag
aaaaaagagattttaaagcataacattggatcgtataatgagatagacgagaggccgatt
aaaccacagatacaagaagcacaaagtcctaagattatcgaatcaaacgaggagaatact
tgtagaactcctcaaaagctagaagaaactttccctaaaccagaagcgaaatctcctaag
cagttagaaacttttgcgaacgaggaagcacagaacttaaatttaataaacactgaagca
gtagcttccacaccgttgcctgttaagaatttaaacaaagcaaagactccaaaaacaccc
aagacaaaaagtgctttattcacaaacgaacctaaatctcctaaacctccagctcaaacc
tcaaagactcccatcaaaagcgaagagattaaagaagagaagaataagctcaattttgat
cagactctagcgatcaacaaatctttagagcagtcttcgttcagcgctaccgaacttata
actaatctagagacaactagtgacgttttacacgaaaacttatgtattgcaccaattcag
gaacctgaatacgaggcctttaaaccaatccagcaaagcaccactctacccttccctgac
tttaaaaaactacaggaagctgctctgtctgtcgcgaaagaaatcgacgaatctttggaa
aaaatagaagagactgaacagtttgtttcagcgactaccgaattatttggggatccgtct
gctcttgattttctcacacaggttggatcgcagcaccccactaagcgaggtgaaagatat
gattcattgtatatgaagtttgatccattagctcaaagactcagtatgctgccccaaaag
aatctcccgaccgccccttcggtagacgaagaggaagagaaagagaaggaagcgaaagtg
aacaaaccttcaagtgagatgggaacaccaaagaaaaatccagccttagcagctattgat
agattacttttctacagtccttgcccacctagtgcgacagaaagtgcagtggcagaagcc
aaacaaaagaaggaagaggcagagaaacaagagtcgccggttgttccatttgtcgacgaa
aaaatggcgaaggaattagaactggtgaggacgactgtacttcaactcgaggcagagctt
gaaaagcagaaacaagagcacagggaacaattggaaaaacaaaaggctgcatacgaagag
aaagtaacccacatgcaaacgaaattcactcaaatgcagtcccaattgacacaggaggtc
aagtgcaaaggccaaatgacggtggtagtagaggagtacgaaaaatcaatcagcaggtta
atagcggaaagggaaaaggaccgaacgagttttgaagtagagaaggcaaaattgcaagag
gaacttcaagtggccaatcagcacctcagtaatacggaagcagctttcagtgacgttcat
tcaaagtacgaacggctgaagaatgttgtttcggcatataagagtaatgaaacagttctt
aaagaaagtattgctgagaaccaagagactatcaagactctcgagaacagatacgaacag
ctgaagagtcatgcaatggcacagcttgagaaggcaaacttagagttgagtgctatcagg
aaacagaatgaagctgagactgtaaaattgaaggcactggtgagaaaggcagagttaaag
agtaagtctctagcagagacagttgaacagaagatcaaggaaaacaaagagctaacacag
ataatcgacgagatgatagcaagggttgattag

DBGET integrated database retrieval system