KEGG   Nasonia vitripennis (jewel wasp): 100114827Help
Entry
100114827         CDS       T01081                                 

Definition
(RefSeq) calcineurin B homologous protein 1
  KO
K17610  calcineurin B homologous protein 1
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Protein phosphatases and associated proteins [BR:nvi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100114827
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5 SPARC_Ca_bdg EF-hand_4 DIMCO_N DUF1885
Motif
Other DBs
NCBI-GeneID: 100114827
NCBI-ProteinID: XP_001608220
NASONIABASE: NV11588
UniProt: K7IR95
Position
4
AA seq 189 aa AA seqDB search
MGNRSSLLLREEEIAQIQEATGFTPNQIERLYSRFTSLDRGDCGTLSREDFLRIPELAIN
PLGDRIVNAFFEESSSDRVNFLQFMQVLAHFRPIKKNVPNTLNSREEKLRFAFKMYDLDN
DDMISKDELLAILHMMVGANISEEQLSSIAERTLSEADVDGDNMINFDEFCKALERTDVE
QKMSIRFLS
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggggaaccgttctagcctacttttacgtgaggaggaaattgctcaaatacaagaagct
actggatttactcccaatcaaatagaacgactgtacagtcgctttaccagcttagatcgt
ggagattgcggtactctcagcagagaagattttttgaggattcctgaattggctataaat
cctcttggagacaggattgttaatgcattttttgaagaaagcagtagtgatagagtcaat
tttcttcaatttatgcaagtccttgcacactttagacctatcaagaagaatgttccaaac
actttgaattccagagaagaaaaactaagatttgcctttaaaatgtatgatttggacaat
gatgatatgatatctaaagatgaactcttggccatattgcacatgatggttggtgctaat
ataagtgaagagcagctttcaagtatagcagaacgaacactttctgaagctgatgttgat
ggcgataacatgattaattttgatgaattttgcaaagcactagagcgaactgatgttgaa
caaaaaatgtcaataaggtttcttagttaa

DBGET integrated database retrieval system