KEGG   Nasonia vitripennis (jewel wasp): 100114827Help
Entry
100114827         CDS       T01081                                 

Definition
calcineurin B homologous protein 1
Orthology
K17610  
calcineurin B homologous protein 1
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Protein phosphatases and associated proteins [BR:nvi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100114827
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
4
AA seq 189 aa AA seqDB search
MGNRSSLLLREEEIAQIQEATGFTPNQIERLYSRFTSLDRGDCGTLSREDFLRIPELAIN
PLGDRIVNAFFEESSSDRVNFLQFMQVLAHFRPIKKNVPNTLNSREEKLRFAFKMYDLDN
DDMISKDELLAILHMMVGANISEEQLSSIAERTLSEADVDGDNMINFDEFCKALERTDVE
QKMSIRFLS
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggggaaccgttctagcctacttttacgtgaggaggaaattgctcaaatacaagaagct
actggatttactcccaatcaaatagaacgactgtacagtcgctttaccagcttagatcgt
ggagattgcggtactctcagcagagaagattttttgaggattcctgaattggctataaat
cctcttggagacaggattgttaatgcattttttgaagaaagcagtagtgatagagtcaat
tttcttcaatttatgcaagtccttgcacactttagacctatcaagaagaatgttccaaac
actttgaattccagagaagaaaaactaagatttgcctttaaaatgtatgatttggacaat
gatgatatgatatctaaagatgaactcttggccatattgcacatgatggttggtgctaat
ataagtgaagagcagctttcaagtatagcagaacgaacactttctgaagctgatgttgat
ggcgataacatgattaattttgatgaattttgcaaagcactagagcgaactgatgttgaa
caaaaaatgtcaataaggtttcttagttaa

DBGET integrated database retrieval system