KEGG   Nasonia vitripennis (jewel wasp): 100115029Help
Entry
100115029         CDS       T01081                                 

Definition
ubiquitin carboxyl-terminal hydrolase 34
Orthology
K11853  
ubiquitin carboxyl-terminal hydrolase 34 [EC:3.1.2.15]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100115029
Peptidases [BR:nvi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100115029
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
4
AA seq 3523 aa AA seqDB search
MCDVCADFHDLLLTYDESENEVANLLVVDVDTILHYVNQWVQRQCMCCYRDIKNFDRFIR
LIHNIVLRTLQQLQEIQQEQQYAEGKKEGTSSSDGDETDKKEKEKNVEEKSQSPQSSRPK
SNWTHQDREKLFHLLSKIFLLNFPLYIAMKHGGAINPLAPAKDEGGYCESHDPEVPAPLI
RAVSVFCHQGGFNLMSACFDMENTLPVGLAHSMVAVICNLKLWLNYGSVIQLFIPLRSRV
MKYMCRLTDKELRTPAVRTMADFMWSAVKDPIDAVLPTFDRDGLDLAFKYFTSTTLTMRL
AGIAQINSHITAFNELCNSETVAEIEQVGHALAMWLTENNIIAHIFGPNLHVEVIKQSHI
VLSFLAMEGRISSMDMDIMWQAAQLKHCARPVYDLLAPLVKHLAPTPVLHLYSLLGKLEP
KEHTEQSLFLVSALIKFIWTSSSAAYTSALAIDSRDPLRHLTVDEGSTSSEPSGMEGSSP
DEEEEPSPAPSEGPSPRKQARGDSECEGASKSKPEAMQAEPSSFAMQEALEPKDPTNSVS
MKDCLEAQDTASKHTSKPQAMDDKPAGSCSEEHTSDADTDDKSCDENSIDLVLRKKKKVL
RKRKRPQKRSSTTTTTTTTTTTTTTSIASQDAIKDAATKKFCTNESLEPFAVNSTLTQVS
EANKSTEGTDHQVVVDTLDRVKQEAIAMDHPVGADQQVPNTAAALLAQRAEKSVSATSSG
NSKYVAAMARHEVVVQSGSSSHDEDDSDIVGVAGGEGASTVTSELACLDHASGSRFLPTC
LDEMLSDEEGSYSSRISNKSEKNMADFDGEESGCEEELAQLAAQHLSAIHMQAYHPHHAH
STMTVRRSVCRAPQVRTVRQSVARLGAQFNLEMVCKPGNTLLWDLLQDDKIGQLGEGLAV
EAEKALCNLLCYNIDRSIPMKFIEGCLENLASNRSVVVSLRILPKLLASFQQFGTMDAHT
ITTWADRERGMMKHFFNNLKTYASTGPKSLYSHQTEVQVRLQFLSSIFSPLGSPDCFRLS
LEQVDTLWHCLAQDPSCADELFSWLLSQAKSTEQHALGMDTLKHLCMRKLPSLPPETISM
TGLSLFQQLCNLARLAAVHLDRPLRDVDSVGMDFLWKIALRAKSTEVSMAAIQYLNGYYM
SRQLTQEIEFVSQCMTHLAAASADLDSNEEASLRCIQRALLLLRTHLEAFRKRYAYHLRR
WALEGRGAGSHIAANTSERSQQLRVFVQPAGISDKTTFTLLSTDYVADLRAEVSKWWDDT
HARLVMDDNKALGATGKSGSSSGSVLGSLLTDGPIRMITQGQELTIEFDEKTLAETGFKD
GQLVFISLGAGRCNGGGRSGKRDMDSPSLLPPPPRDSLPTLLLLRPQYFEQLFTLMRTLG
AMKTVSKGGQEIPHAKAQVLSRRVWDTLTLLPTSPTLLQGFQKLDDASLPELLDPSNPHK
LMYSLYIVESLSKRSTRRDMMSSLAHEGGGDASSGDTSSGDSDDTPTDWSSTFVRHGGLR
HLFDIFMSGCLENSDGSEWQQDCLASLLKQLCHLGVARDGKRRNKADKLAIPRLSKELSA
LMDLKTVLPRITNILEEASQPRDPNQYKTGLFGRSQVIHYAMALLVCWVHSDPSIGQSLF
ASDKPFGKTWLRRLVLEDPEPAVRREVCTALYKLCLGSVESEEDILASCLLDSSPANLIV
PLLSELLEYLPIAETMQPTRRKIDITMHLHQALEEGKETYGPACRDYFWLICRLIESLPE
DAIQESTSEKSGSTVDLQALATRAIKSILARDYVETRHNTVEDDGLVGLLNLCCNIMAHN
PPCKQGKVGQNLLSRVFDFLFALPNPSAKHMPKCKSQASRSAAFDLLVELVKSAPENYRI
LHKKLLTQHKPGRHSPYSWDYWPHDDGRSDCGYVGLTNLGATCYMASCMQHLYMMPQARI
AILGADCNRANKHQLTLRELQRMFAYLLESERKAYNPRSFCRVYTMNHEPLNTGEQKDMA
EFFIDLVSKLEEMTSDLKTLVKTLFCGIISNNVVSLDCEHVSRTLEEFYTVRCQVADMRN
LYESLDEVTVKDTLEGDNMYTCSQCGKKVRAEKRACFKKLPRILCFNTMRYTFNMGTMLK
EKVNTHFSFPLRLDMSGYMEKKLIPRHCQQENEKSENNQSNKDQDMEGSGTSGGSQEKQD
EHCQYDLIGVTVHTGTADGGHYYSFIRDRTCPNKDKWFLFNDAEVKPFDPNQIAAECFGG
EMTSKTYDSVTDKFMDFSFEKSNSAYMLFYEWCPDPSDSPLVKEDEACGSSPTSLEPPAH
QQIQQRPSSPAADVMPPLELNRELEEWIWQDNMHFLQDKNIFEHTYFSFMWQICNYIPQT
LIAAQPDVTELSAELSASFFMETFIHAKEKPTMVQWVELLTKQFNNSLTACAGFLEKMAA
DSWWPVQILVKCPNQMVRQMFQRLCIHVISRLRPSQAPFYLVCEADDDPSTVGMQSCVTR
FVRMLLSLMEHAKQHLKHLTEYFAFLYEFSKMGEEETMFLIKAQAISTMVNFYLGHKTHE
FVDAISEEEEEEEVVAISTEKLRPASLDKMITLIATLVERSRVPDHRLNLSSSDFNAVAG
GKGFPFLYQQIRDMINLNQTRNLIQSLCRWNDRLAIHIVTMIFQAITKHTDVCQPFFKIL
TLLTEGSSPPGLPCMTQLILSRVWEVARIAPHGALEWLALAVTRSKLAHAWVLQGMDTWL
QHFLIEHSNQRVRSAAAFLLVSLVPSAHFRQGYRSAHRLGLSCATARELSLTNEGTVVLH
QIYTALLRLLQPARHYTDLNTHGTMKLTAYFALMTYCVVSTTEKLMFGQYLNDLWTLFHP
KLSEPSIPVHHNKQALLLFWYHVSNDCPENVALILQNPHITKNIAFNYILADHEDQDVVL
FNRVMLPAYYGLLRLCCQQSHTFTRQLAAHQNIQWAFKNITPHPTQYSTAVEELFKLMQL
LVARHPDQTEQEEAEVASFRRGTLSSYLQGLDGRSCWATLISAFRILIESDDDRLYVVYN
GGLSMALEAFHMLHIMYHEATACHVAGDLAELIAIIVELVRCVRTARDGPDARNILANCK
EWPDVLRKLATLLNTYNPSDMRNLAIDLLKELVMLVPTDAILILAPLLSHCHAALQESHA
TVPPGPYLPRRATPAGKMPSRPARPMVQMAVPHSQLEAAKGTDLEYDSALLEFYLPYHEL
IDVMCRLAINNDCMTEILINLSAMLGFEGVPLHLALFPRLWLDVHAASHIDRKHIAALLR
CSYTVDYVDAVLLDERSSLAVPAIHAFLKTFFPKLASHVLTEQTCSIIDSLVSTLTSMVE
VVDVQESAHRLTGDLRALALVYSSGADVKPPPTLHSALETLLTRTKAARARLKESKQPDA
EAPTKKRKFNTSDEIEDEEDDEDDEEEESTSSPGMEDQKESNESPQSTSATTASTVATTA
STTSMATLSTPSVTTATVSDSPATTSIKDKSKEQEEAQAAKPSEAEKTDQTDAKSSSSLI
TASSTTSNWNSQLCRSMNNVSWLDMLEKTIANLQMIVQFQSKN
NT seq 10572 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgatgtgtgcgccgactttcacgatcttctgctcacctatgatgagagcgaaaat
gaggtagcgaatcttcttgttgttgatgttgatacaatattacattatgtgaatcaatgg
gttcaaagacaatgtatgtgctgttatcgcgatataaaaaactttgatcgatttatcaga
ctgattcataacattgtccttcgcactctgcaacaattgcaagaaatacaacaagagcaa
caatatgctgaaggcaaaaaggaagggacaagcagcagcgatggagacgagactgataag
aaggagaaagaaaagaatgtggaggagaagtcacagagtccgcaatcgtcgagacccaaa
tcaaactggactcatcaagacagagaaaaattatttcatctcttgtccaagattttttta
ttaaattttcccctttacatagccatgaaacatggtggagctatcaaccctttggctcct
gcaaaagatgagggaggatactgtgagtcacatgatccagaggtgccggcacccttgatt
cgtgcagtatcagtgttctgtcatcagggtggatttaatttaatgtcagcttgttttgat
atggaaaatacactgcccgttggtcttgcgcactctatggttgcagttatttgtaattta
aagctttggttgaattatggtagcgtaattcaattgtttatacctttacgtagtcgagtt
atgaagtacatgtgccgattgactgacaaagagttgagaactccagccgtgagaaccatg
gcagatttcatgtggagcgcggtgaaagatccgatagatgcagtcctgccgactttcgat
cgcgatggtttggatttggctttcaagtactttactagcacaaccctgacgatgcgcctg
gctggcatagcgcaaatcaactcgcacatcacggccttcaatgagctgtgtaacagcgag
accgtggcagagattgagcaggtcggtcacgctcttgccatgtggctcaccgagaacaat
atcatagcacatattttcggtccaaacctgcacgttgaagtgataaaacagagccacatt
gtgctgagctttttggcgatggaaggtcgcatctcttccatggacatggacataatgtgg
caggcggctcagttaaagcactgcgctcgccctgtctacgacctgctggcaccgctggtc
aagcacctagcaccaacaccagtgctacatctttattcgctcttgggcaagctcgagcct
aaagagcatacggagcaaagtttgtttctcgtgtcggccctgatcaagttcatctggacg
tctagcagcgctgcttacactagtgctctcgctatcgacagcagagatcctttgaggcat
ttaactgtcgatgagggaagcacgagcagtgaaccaagtggcatggaaggcagtagtcct
gacgaggaggaggagccaagccccgcaccctcggagggcccgtcgcccagaaagcaggca
agaggcgatagcgaatgcgaaggtgcgtcgaaatccaagccagaggcaatgcaagcagag
ccgtcatctttcgccatgcaagaggcgcttgaacccaaggatccaaccaactcggtatcc
atgaaagattgtctggaagctcaagatacggcgagcaaacacacgagtaaaccacaagca
atggatgacaaacctgctggcagttgctcagaagagcacacgagtgatgcggacaccgac
gataagtcttgcgatgaaaattcgatagatcttgtcttgagaaagaagaagaaggtttta
cgcaaacgtaagagaccgcaaaagcgctcatccaccacaacgacgacgactacgaccact
actaccacgacgactagcatcgcgagccaagacgcaatcaaggatgcggcgacaaaaaag
ttttgcactaatgaatctctcgagccatttgcggtcaatagtaccttgacacaggttagt
gaggcgaacaagagcacggagggtacagatcatcaagtggttgtcgatactttggacaga
gtaaagcaggaagcaatcgccatggaccatcctgtgggtgctgaccaacaggtgccgaat
acagccgctgcattgctcgctcagagagcagagaaaagtgtcagtgctactagtagcgga
aacagtaaatacgtagcagcgatggcgaggcacgaggttgtggttcaatctggatccagt
tcccacgacgaggacgacagcgatatcgttggtgttgccgggggtgagggagcgagcact
gtcacgtcagagctagcttgtctggaccacgcgagcggttcgcgtttcttaccaacctgt
ctcgacgagatgctctccgatgaggaagggtcctacagcagtcgcatatccaataagagc
gagaagaatatggctgacttcgacggcgaagaaagcggctgcgaggaggagcttgcccag
cttgcggctcagcatctttctgcaattcacatgcaggcctatcatccgcaccacgcacat
tcgacgatgacggtgcgtcgctcggtctgccgtgcgccccaagtacgtactgttcggcaa
agcgtcgcacgtctcggtgctcagttcaatctcgagatggtctgcaagcctggcaacacg
ctgctctgggatctattgcaagacgataaaatcggacagttgggagaaggtttagccgtg
gaggccgaaaaagctttatgcaatttgctgtgctacaacatcgatcgctcgataccgatg
aaatttatcgaaggatgtctggagaatctcgcttcgaatagatcggtcgttgtgtctctg
aggattcttcccaagcttcttgccagttttcaacaattcggtaccatggatgctcacaca
atcactacgtgggcggatcgcgaacggggcatgatgaagcattttttcaacaatctcaag
acgtacgccagcacgggacccaagagtctctactctcatcagacggaggtacaagttcgt
ttacagttcctctcttcaatattctcgccgcttggatctcccgactgcttccgcctgagc
ctcgaacaagtcgacacactctggcactgtcttgcccaagatccatcctgcgccgacgag
ctcttcagctggctgctaagccaagccaagtcaactgagcagcacgccctcggcatggac
actttgaaacatctgtgtatgcgtaaacttcccagtttaccaccggaaacgataagcatg
actggtctgagtctcttccaacagctctgcaatctagcgaggctggcagctgtacatctg
gaccgaccgcttagagacgtggactcggttggcatggactttttatggaagatcgctttg
cgcgccaagagcaccgaggtgagcatggccgcgatccagtacctcaacggttactacatg
tctcgtcagcttacccaggagatcgagttcgtctcgcagtgcatgacgcatctcgcagcc
gctagtgctgacctcgatagtaacgaagaagctagcttgcgctgcattcagcgagctttg
ctgttgctcagaacgcatctcgaagctttccgaaagcgatatgcctaccacttgcgcagg
tgggcactggaaggtagaggcgcaggcagccacatcgccgctaatacatccgagagaagt
cagcagctgcgagtgtttgtgcagccagcaggcatttccgacaaaactacttttacgctt
ctaagcacggattacgtagcggatctgagagccgaggtatccaagtggtgggatgacacc
cacgcacgtctcgtcatggacgataacaaagcacttggtgcaacgggcaaatcgggtagt
agttcgggatcggtgctgggttcactgctgaccgatgggccgatcaggatgattacacaa
ggacaggagcttacgattgaatttgatgagaaaacgttggcagaaacgggattcaaggat
ggacagctagttttcatttcgttgggagctggaagatgcaacggaggtggaagatctggt
aaacgtgacatggactcaccgtcgttgctgccgccaccaccccgggattctctacccaca
ctcttactgttgagaccacagtatttcgaacagctatttacactgatgaggacgttaggt
gctatgaagactgtttcgaaaggtggtcaagaaataccgcacgcgaaagcacaggtactg
tctcgccgagtctgggatacactaactcttcttccaacaagccccacgctgttgcaagga
tttcaaaagctcgacgatgcctctcttccagaactgctggacccgtcaaatccgcacaaa
ctcatgtattccctttacatcgtcgagtctctctccaaacgttcgacccgtcgcgatatg
atgtcttcgctggcacacgaaggtggcggtgatgctagtagtggtgataccagcagcggt
gactcggatgacacacctaccgattggtcctctacttttgtgcgtcacggtggcttacgc
cacctcttcgacatcttcatgtccggctgtctggagaatagcgacgggagtgaatggcag
caagactgtttggctagtctgctgaaacaattatgtcatcttggagtggcgagagacggc
aagaggagaaacaaagctgacaaactcgcgatcccacgattaagcaaagagctctcggct
ttgatggacttaaagactgtgctacctaggataacgaatatactcgaagaggcgtcgcag
ccacgagatcccaaccagtataaaaccggactttttggtcgctcgcaggtcatacactac
gccatggctctgttggtgtgttgggtgcacagcgacccctcgattggccagtcgctcttt
gcctctgacaagccttttggtaaaacgtggcttcgtagactcgtactagaggatcccgag
cccgctgtacgtcgcgaggtatgcactgcactctacaaactctgcctcggtagtgtcgag
tccgaagaggatatcttggcatcctgtcttttggattcgtcacctgccaaccttatagtt
cccctgcttagcgagctactagaatatctaccgatcgccgaaacgatgcaaccaacacgg
cggaaaatcgacataacgatgcacctccaccaggcgctcgaagaaggaaaagaaacgtat
ggcccagcctgccgcgattacttttggcttatttgtcgtctgattgaatcgttgcccgaa
gacgccattcaagagagcacgagcgaaaaatcgggtagcacagtagatctgcaggccctt
gccacccgcgcaatcaaatcaattctggcaagggattatgtggaaacgcgtcacaatacc
gttgaagatgatggcctcgtgggcttgctcaatctttgctgcaacattatggcgcacaat
ccaccttgcaagcagggcaaagttggacagaatttgctcagtcgagtattcgatttcctt
tttgctctgccaaatcccagtgccaaacacatgcccaagtgcaagagtcaggcgtcaaga
tcggcagccttcgatttactcgtggagctcgtgaaatcggcgccggagaactatagaata
cttcacaaaaaattactgacgcaacataaaccgggacgacattctccctattcgtgggat
tactggcctcacgacgatggacgctccgattgcggctatgtgggccttacgaatttgggc
gcgacttgctacatggctagctgtatgcaacatttgtacatgatgccccaagctcgaatt
gctattttgggtgctgactgtaatcgagccaataagcatcagttgacgttaagagaattg
cagagaatgtttgcttatctcctcgagtcagaaagaaaagcgtacaatccaaggagcttt
tgccgtgtctatacgatgaaccacgaacctctgaataccggcgagcaaaaggatatggcc
gaatttttcatagatctcgtgtcaaagttggaagagatgacgagcgacctcaagacactc
gtcaagacacttttctgcggtataatatcaaacaatgtcgtctcccttgattgtgaacac
gtgagtcgtacgctcgaagaattttataccgtgcgttgtcaggttgcagacatgaggaat
ctttatgaaagtcttgacgaagtcacggtaaaggacaccctagaaggcgataatatgtac
acatgctcgcaatgcggcaagaaagtcagagccgagaagcgcgcttgcttcaagaagctg
ccacgcattctctgctttaataccatgcgatacactttcaacatgggcacaatgttgaaa
gagaaggttaacacgcatttcagttttcccttgcgactcgacatgtcgggctacatggag
aaaaagttgataccgcgtcactgccagcaggaaaacgaaaaatccgaaaataaccagagt
aataaggaccaagatatggaaggcagtggtaccagcggtggaagccaagagaagcaagac
gaacactgccagtacgatttgataggagtcacggtacacacgggcacggccgatggtggt
cactactacagcttcattcgtgaccgcacgtgtccaaataaggataaatggttcctcttc
aatgatgctgaagtcaagccgttcgatcccaaccaaattgcagctgaatgcttcggcggt
gaaatgaccagcaagacctatgactcggtcacagacaaattcatggacttcagctttgaa
aaatccaactctgcgtacatgctattttacgagtggtgtcccgatccaagcgattcgcca
ctcgtcaaggaggacgaggcttgtgggtccagtcccacatcccttgaaccacctgcgcat
cagcagattcagcagcgaccgagcagcccagcagcagatgtgatgccaccgcttgagctc
aatagagaactggaagaatggatttggcaggataacatgcattttcttcaggacaaaaat
atcttcgagcacacgtactttagcttcatgtggcagatttgcaactatattccgcagact
ctcattgccgcacagccggatgttacggaactatcagctgagctgtcggcgtcgtttttc
atggaaacgtttatacacgccaaggagaaaccgaccatggtgcagtgggtcgaacttttg
acaaaacagttcaataattccctgacggcttgtgcgggtttcctagagaaaatggctgcg
gactcgtggtggcccgtccaaattctagtcaagtgtccgaatcagatggtcaggcagatg
tttcagaggttgtgtattcatgttatatcgagactgcgaccatctcaggcgccgttttat
ctcgtatgcgaagcggatgacgatcccagcactgtcggcatgcagtcctgtgtgacacgc
tttgttcgcatgctgctctcgttgatggaacacgccaagcagcatttgaaacatctcacc
gagtatttcgcctttctttacgagttcagcaagatgggcgaagaggaaacgatgttcctt
ataaaagctcaagcgatttcgactatggttaacttctatcttggccacaaaacgcacgag
tttgtcgacgccatcagcgaagaagaagaagaggaagaggttgtggctatatccactgaa
aagctgaggcctgcatctttggataagatgatcaccttgattgcaacgctggttgagcgc
agccgagttccagatcacaggttaaacttgtcaagttcggattttaatgcggtggccggt
ggcaagggctttccattcctctaccaacaaatccgtgacatgatcaacctcaatcagacg
cgcaatctcattcagtcgctctgtcgatggaatgacagactcgctatccacatagtaacc
atgatattccaggccatcaccaagcatacggatgtttgtcagcccttcttcaagattctt
actctgttaaccgagggcagcagcccaccgggactgccctgcatgacacagttgattctc
agtcgcgtgtgggaagtagcaaggatcgcgcctcacggtgccctagagtggcttgctctc
gccgtcacacgtagcaagctcgcgcacgcatgggttcttcaaggtatggatacctggctc
cagcacttccttatcgagcactcaaatcaacgagttcgatcagctgccgctttcttgctg
gtctcgttagtaccctcggcgcacttccgacagggttacagaagtgcgcacaggctgggg
cttagctgtgctacggcaagggaactgtcgctcaccaacgaggggaccgtggttctgcac
cagatctacacggctctgctaagactgctacaaccggcaaggcattacacggatttaaac
acacatggaactatgaaactcactgcctatttcgcattaatgacgtattgcgtcgtctct
actactgagaaactcatgtttggacaatatctaaatgatctttggacgcttttccatcca
aagctttcagaaccaagcattccagtacatcataacaaacaagcacttttgcttttctgg
tatcacgttagcaatgattgtcctgaaaacgttgcactcattcttcaaaatccgcacatt
acgaaaaacatagcattcaattatattttagctgatcacgaagaccaagatgttgttctt
ttcaatcgtgtaatgcttcctgcatattatggcttactaagactttgttgtcaacagtcg
catacatttacaagacaattagctgcgcatcaaaatatacaatgggctttcaaaaatata
actcctcatcctactcaatattcaactgctgtggaggaactgttcaaattaatgcagctc
ctagttgcccggcatccggaccaaactgaacaagaagaggctgaagttgcatcgttcagg
agaggaactttgtcttcctatctacaaggactggatggacgatcgtgctgggcaactctc
atatcggcatttaggattttaatcgagtccgacgacgatcgcttgtacgtcgtatataac
ggcggtctttcgatggctcttgaagctttccacatgttgcacattatgtaccacgaagcc
acggcttgtcacgttgctggtgatttggccgaactcatagctatcattgtcgagctagtt
cgttgtgtacgaacagctcgcgatggacccgacgctcgcaacattctcgcgaactgcaag
gagtggccggatgtgctgcgtaaacttgccactctcctaaatacctacaacccctcggat
atgcgcaatctagcgatagacttgcttaaggagctcgtgatgcttgtgccgaccgacgca
attcttattctggcgccactgctttcgcattgtcacgcagcattacaagaatcgcacgca
acagtacctccaggtccgtatttacccaggcgggctacgccggccggaaaaatgccgtcg
aggccggcgaggcctatggtacaaatggctgtaccacattcacaactcgaggcagccaaa
ggtacggatctcgagtatgacagtgcgctgctggaattctatctgccttatcatgagctt
atcgatgtaatgtgcagactagcaatcaacaacgattgcatgacggagattcttattaat
ctaagcgctatgttaggtttcgaaggtgttccactgcatttagctctatttccaagactg
tggctagatgtgcacgcggcaagtcacatcgacaggaaacatatagccgcactacttcgc
tgttcgtatactgtggattatgtggatgcggttctattggacgaaaggtcgtcgctagct
gtgccagcgattcacgcttttctcaagacctttttccccaagctcgctagccacgtactt
accgagcagacatgctcgatcatcgacagcctcgtgagcacgcttacatccatggttgag
gttgtcgatgttcaggaatccgcgcacagattgaccggtgatctgcgagccctggctctg
gtctacagcagtggtgccgatgtcaagccaccacctacgctacactctgcactcgaaaca
ctgttgacgcgcactaaagcggcgagagcccgtctcaaggaatcgaaacaacctgatgca
gaagctcccacgaagaagcgcaagttcaacacatcggatgaaattgaagacgaagaggat
gacgaggatgacgaggaagaggaaagcacttcgagccctggcatggaggaccagaaggag
tccaatgagtcaccgcagtcaacttcagcgacaacggcaagcacggtggcaactacagct
agcacgacatcgatggcgactttaagtacgccttcggtgacgactgctacggtatcagat
tcgccagcgacaacaagcatcaaggataaaagcaaggagcaggaggaggcgcaggccgcc
aagcccagcgaggcggaaaagactgaccaaaccgatgccaagtcgagctcgagtctgatt
actgcaagcagcactacaagcaattggaacagtcagttatgcaggtctatgaacaacgtg
tcatggttggacatgctcgaaaagactattgcgaatctacagatgatcgtgcagttccag
tcgaaaaattaa

DBGET integrated database retrieval system