KEGG   Nasonia vitripennis (jewel wasp): 100115081Help
Entry
100115081         CDS       T01081                                 

Definition
acyl-CoA Delta(11) desaturase-like
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100115081
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    100115081
Enzymes [BR:nvi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     100115081
Lipid biosynthesis proteins [BR:nvi01004]
 Desaturase
  First
   100115081
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
3
AA seq 398 aa AA seqDB search
MLSFPRRAAVSSSSLFRARSMILDRSMAPNLFGNSAALFLEAAQQGIPEEKPVSNSKPTY
LEAQKSDKSKYTWKIVWRNVIAFVYLHVGALYGFYLFFHGAKILTVLWTILIACSAALGI
TAGAHRLWCHRAYKAKWQLRLILMIFQTIAFQNHLYEWVRDHRVHHKFTDTDADPHNAKR
GFFFSHMGWLLVRKHPDVIAKGASVDMSDLETDPIVVWQRRLYIILMPIFCFLLPAWIPC
YFWGENGMYSWYATIFRYTASLNLTWLVNSAAHIWGTRPYDETISATDNIRVALGAFGEG
WHNYHHVFPWDYKAAELGDYKANFTTAFIDFFARIGWAYDLKTVPVELVEKRAARTGDGN
RIKQSSPEHSHEDAIWGWGDKDMHQEDIEYATIINKAD
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgctctccttcccgcgacgcgccgcggtttcttcctcctctctctttcgggcgagatca
atgatcctagaccgctcgatggcgccgaatctgtttggaaattcggcggcgctcttcctg
gaagccgcgcaacagggcatacccgaggagaagcccgtgtcgaattcgaagccgacctac
ctcgaggcgcaaaagtccgacaagagcaagtacacgtggaagatcgtctggaggaacgtc
atcgccttcgtctacctccacgtgggcgcgctctatggattttacctgttcttccacggc
gccaagatcctcaccgttctgtggacgatcctcatcgcctgctcggctgcgctgggtatc
acggcaggagcccacagactctggtgccacagagcttacaaagccaagtggcagctgagg
ctgatcctcatgatcttccagaccatcgccttccagaatcacctgtacgagtgggtgagg
gatcaccgggtgcaccacaagttcacggacacggatgccgacccgcacaacgccaagaga
ggtttcttcttctctcacatgggctggctgctcgtccgcaagcatcccgacgtcatcgcc
aaaggcgccagcgttgacatgagcgatctcgagaccgatcccatcgtcgtctggcaacga
aggctctacatcatcctgatgccgatcttctgcttcctcctgcccgcctggatcccctgc
tacttctggggcgagaacggcatgtactcgtggtacgcgacgatcttccgatacacagcc
tcgctgaacctcacgtggctggtcaactccgcggctcacatctggggcaccagaccgtac
gacgaaaccatcagcgcaaccgacaacattcgcgtggccctgggagcctttggcgagggc
tggcacaactaccaccacgtcttcccctgggactacaaggcggccgagttgggcgactac
aaggccaacttcaccaccgccttcatcgacttcttcgcacggatcggctgggcctacgat
ctgaagacggtaccggtcgagctggtggagaaaagggccgcgagaaccggcgacggaaat
cgcatcaagcagagctcgccggagcacagccacgaggacgcgatctggggatggggcgac
aaggacatgcaccaggaggacatagagtatgccaccatcatcaacaaggccgactag

DBGET integrated database retrieval system