KEGG   Nasonia vitripennis (jewel wasp): 100115096Help
Entry
100115096         CDS       T01081                                 

Definition
(RefSeq) L-asparaginase 1
  KO
K13278  60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100115096
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     100115096
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     100115096
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asparaginase Ank_2 Ank_3 Ank Ank_5 Ank_4
Motif
Other DBs
NCBI-GeneID: 100115096
NCBI-ProteinID: XP_016840542
NASONIABASE: NV11271
UniProt: K7IQD3
Position
4
AA seq 637 aa AA seqDB search
MSETDFTCNANMLSANSSSQNTPVENNKSNGTNGEEHIIRRNVSSGAFPQESKPEGRVLV
LYTGGTIGMVRNKDGALVPIANAFVKNLRRYPNMHDKEYAEERFGPMGPLVLPMTDVDSR
RIIYNVLEYKPLCDSSNMRMDDWIRIARDIQESYEHFDGFVILHGTDTLSYTASALSFML
EALGKIVVLTGSQLPLFDTRSDGLDNFLTSLVIAANYNIPEVCIFFGTRLMRGNRTTKAS
VTAFEAFHSPNAPPLAVAGIKIDVDYRSIFRTCHMEKFHVHTTLNKKVGLLRLFPSITAD
LVKAFLRPPIEGVVLQTYGAGNVPSNREDIIAEFKAAADRGVIIINITQCSEGSVCSIYE
VGKILMDAGVLSGFDMTPEAALTKLAYVLSKTEWDTATKRSMMETNLRGELTAGRSVTLQ
DWDLVDAVGRSLRISSPSEFKELGAILFPAMMNAAVLAKDTMKLSSLKRYGADISQPNAD
GRTALHIACCEGDITVVRHLLKMGANVHIKDRFNRTPLTDAIEHDRPEIIKLLLQCGAHL
HERGRLIGERMCSAAAAGNLARLRSYHLAGADLSQADVSGRTALHLAAEHGQSAVVQFLL
EHGAETKASDKLGMTAKDVANPECLRLLNGENGSNKV
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaacagattttacatgcaatgcaaatatgttgagtgcaaattcaagttcccaa
aatacccctgtagaaaataataaaagtaatggtacaaacggcgaagaacacattattcga
cgaaatgtatcttctggggcattccctcaggaaagtaaacctgagggtagagtattagta
ctgtacacgggaggcaccattggaatggttagaaataaggatggagctcttgtcccaata
gctaatgcttttgtgaaaaacttaaggagatatcctaacatgcatgataaagaatatgcc
gaagaaagatttgggccaatggggcctttagtattgccaatgactgatgttgacagtaga
agaattatttacaacgttttagaatataagccattatgtgattcaagtaatatgagaatg
gatgattggatacgtattgcacgtgatatacaagaatcttacgaacattttgatgggttc
gtcattctgcatggaactgatacattaagttacaccgcctcagcactgtctttcatgtta
gaagcacttggaaaaatcgtagtgctaacaggatcgcagctgcctctattcgataccaga
agtgatggtcttgacaattttttgacttcgctagtcatcgccgccaattacaacattccc
gaagtttgtatcttcttcggaactcggctcatgcgagggaaccgcactacaaaagcttct
gtcactgcgtttgaagcttttcattctccaaatgctccgcctctagccgttgctggaatt
aaaatagatgtggattatcgttctatattcagaacttgtcatatggaaaagtttcacgtt
cacacaacgctaaataagaaggttggtctccttcgactgttccccagtataaccgccgat
ctggtgaaagcttttcttcgtccaccaatcgaaggggtagtcctgcaaacctatggcgca
ggaaacgtaccgtctaatcgagaagatatcatagccgaatttaaagctgcagcagatcgg
ggtgtcatcatcataaatatcacacagtgctcagaaggaagcgtgtgttcaatatacgaa
gttggaaagatactcatggatgctggtgttttatctggcttcgacatgacgcccgaggct
gccctcacgaaactggcctacgttctgtccaagactgaatgggacacggctacaaaacgc
tcgatgatggaaacgaatttgcgaggagaactgactgctggacggtcggtcactttgcag
gattgggatctcgttgacgcagtcggcaggtcgttgagaataagctcaccatccgagttc
aaggagctgggtgctatcctcttccctgcaatgatgaatgccgctgtgctggctaaagac
acgatgaagctaagctctctcaagagatatggagcagatatttcccaaccaaacgccgat
ggcagaacggcgttgcatattgcctgttgcgaaggagatatcacagtagtgcgtcattta
ttgaaaatgggagcgaacgtgcacatcaaagatcgattcaatcgaactccattgacggat
gcaatagaacacgaccggcccgagataataaagttgttgctgcaatgtggcgcacacctg
cacgagcgcggccgtctcatcggcgagcgtatgtgttcagccgctgctgcaggaaacctc
gctcgattacgctcctatcacttggcgggggctgacctgtcgcaggccgatgtctctggt
agaacagctctgcatctcgccgccgaacatggtcagtccgcggtggtgcagtttctgttg
gaacacggggctgagacgaaagcctcagataagctcggtatgacggctaaggatgttgct
aatcctgaatgccttagactgctcaatggtgagaacggcagcaataaggtttga

DBGET integrated database retrieval system