KEGG   Nasonia vitripennis (jewel wasp): 100115096Help
Entry
100115096         CDS       T01081                                 

Definition
L-asparaginase-like
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
4
AA seq 637 aa AA seqDB search
MSETDFTCNANMLSANSSSQNTPVENNKSNGTNGEEHIIRRNVSSGAFPQESKPEGRVLV
LYTGGTIGMVRNKDGALVPIANAFVKNLRRYPNMHDKEYAEERFGPMGPLVLPMTDVDSR
RIIYNVLEYKPLCDSSNMRMDDWIRIARDIQESYEHFDGFVILHGTDTLSYTASALSFML
EALGKIVVLTGSQLPLFDTRSDGLDNFLTSLVIAANYNIPEVCIFFGTRLMRGNRTTKAS
VTAFEAFHSPNAPPLAVAGIKIDVDYRSIFRTCHMEKFHVHTTLNKKVGLLRLFPSITAD
LVKAFLRPPIEGVVLQTYGAGNVPSNREDIIAEFKAAADRGVIIINITQCSEGSVCSIYE
VGKILMDAGVLSGFDMTPEAALTKLAYVLSKTEWDTATKRSMMETNLRGELTAGRSVTLQ
DWDLVDAVGRSLRISSPSEFKELGAILFPAMMNAAVLAKDTMKLSSLKRYGADISQPNAD
GRTALHIACCEGDITVVRHLLKMGANVHIKDRFNRTPLTDAIEHDRPEIIKLLLQCGAHL
HERGRLIGERMCSAAAAGNLARLRSYHLAGADLSQADVSGRTALHLAAEHGQSAVVQFLL
EHGAETKASDKLGMTAKDVANPECLRLLNGENGSNKV
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaacagattttacatgcaatgcaaatatgttgagtgcaaattcaagttcccaa
aatacccctgtagaaaataataaaagtaatggtacaaacggcgaagaacacattattcga
cgaaatgtatcttctggggcattccctcaggaaagtaaacctgagggtagagtattagta
ctgtacacgggaggcaccattggaatggttagaaataaggatggagctcttgtcccaata
gctaatgcttttgtgaaaaacttaaggagatatcctaacatgcatgataaagaatatgcc
gaagaaagatttgggccaatggggcctttagtattgccaatgactgatgttgacagtaga
agaattatttacaacgttttagaatataagccattatgtgattcaagtaatatgagaatg
gatgattggatacgtattgcacgtgatatacaagaatcttacgaacattttgatgggttc
gtcattctgcatggaactgatacattaagttacaccgcctcagcactgtctttcatgtta
gaagcacttggaaaaatcgtagtgctaacaggatcgcagctgcctctattcgataccaga
agtgatggtcttgacaattttttgacttcgctagtcatcgccgccaattacaacattccc
gaagtttgtatcttcttcggaactcggctcatgcgagggaaccgcactacaaaagcttct
gtcactgcgtttgaagcttttcattctccaaatgctccgcctctagccgttgctggaatt
aaaatagatgtggattatcgttctatattcagaacttgtcatatggaaaagtttcacgtt
cacacaacgctaaataagaaggttggtctccttcgactgttccccagtataaccgccgat
ctggtgaaagcttttcttcgtccaccaatcgaaggggtagtcctgcaaacctatggcgca
ggaaacgtaccgtctaatcgagaagatatcatagccgaatttaaagctgcagcagatcgg
ggtgtcatcatcataaatatcacacagtgctcagaaggaagcgtgtgttcaatatacgaa
gttggaaagatactcatggatgctggtgttttatctggcttcgacatgacgcccgaggct
gccctcacgaaactggcctacgttctgtccaagactgaatgggacacggctacaaaacgc
tcgatgatggaaacgaatttgcgaggagaactgactgctggacggtcggtcactttgcag
gattgggatctcgttgacgcagtcggcaggtcgttgagaataagctcaccatccgagttc
aaggagctgggtgctatcctcttccctgcaatgatgaatgccgctgtgctggctaaagac
acgatgaagctaagctctctcaagagatatggagcagatatttcccaaccaaacgccgat
ggcagaacggcgttgcatattgcctgttgcgaaggagatatcacagtagtgcgtcattta
ttgaaaatgggagcgaacgtgcacatcaaagatcgattcaatcgaactccattgacggat
gcaatagaacacgaccggcccgagataataaagttgttgctgcaatgtggcgcacacctg
cacgagcgcggccgtctcatcggcgagcgtatgtgttcagccgctgctgcaggaaacctc
gctcgattacgctcctatcacttggcgggggctgacctgtcgcaggccgatgtctctggt
agaacagctctgcatctcgccgccgaacatggtcagtccgcggtggtgcagtttctgttg
gaacacggggctgagacgaaagcctcagataagctcggtatgacggctaaggatgttgct
aatcctgaatgccttagactgctcaatggtgagaacggcagcaataaggtttga

DBGET integrated database retrieval system