KEGG   Nasonia vitripennis (jewel wasp): 100115114Help
Entry
100115114         CDS       T01081                                 

Definition
acyl-CoA desaturase 1-like
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:nvi01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:nvi01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
3
AA seq 323 aa AA seqDB search
MPAERMDDYKRDIHWPTVLYYIHLHALGFYGAILLLTEAKWLTVFFTLFIILIAGLGITL
GAHRLWAHGAFEASGFVRGFLMVAHTLAGVGNIYDWVLAHRTHHKFYGTSRDPYNHKKGF
WYSHLLSNVLSTHPDKERMDKDIDMCDVDYDGYVWVQRWFYWLLFPVVGLLLPINAPAEY
WGESIKNTVFILGFFRLAVTTNFSWLVNSAMLVWGLKPGDKFPADDNTIFLLNKSYWPNY
HYLLPWDYKCGEFGNYDRGCSTFFIKMWENLGLVDSLKTASSESIRDALYRAASQKLDVP
EALESVKKIADEETIKAKLRYHH
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgccggcggagcggatggacgattacaagagggacatacattggccgaccgttttgtat
tacatacatctacacgcccttggattctatggagccatcctgctgcttaccgaggctaaa
tggttgactgtattcttcacgctgttcataattttgatcgccggactgggcatcacgctc
ggcgctcacagactatgggcccacggcgcgttcgaggcgtcgggcttcgttcgaggcttc
ctgatggtggcgcacacgctggccggtgtgggtaacatctacgactgggtactggcgcac
agaactcaccacaagttctacggaacctcgagggacccttacaaccacaagaagggcttc
tggtacagccacctcctgtccaacgttctctcgactcacccggacaaggagcgaatggac
aaggacatcgacatgtgcgacgtcgactacgacggctacgtctgggttcaaagatggttc
tactggctgctcttcccggtggtcggtctcctgctaccgatcaacgcaccggccgagtac
tggggcgagtcgatcaagaacaccgtcttcatcctcggcttcttccgtctggccgtcacg
acgaatttctcctggctggtgaacagcgcgatgctcgtctggggcctgaaacccggagac
aaattccccgccgacgacaacacgatcttcctgctgaacaagtcctactggccgaactac
cactacctgctgccctgggactacaagtgcggcgagttcggcaactacgaccgcggctgc
agcaccttcttcatcaagatgtgggagaacctcggcctcgtcgactccctcaagacggcc
tcgagcgagtcgatccgcgacgctctctatcgcgctgccagtcagaaactcgacgtgccc
gaggctctcgagtccgtgaagaagatcgccgacgaggagacgatcaaggccaagcttcgc
taccatcactga

DBGET integrated database retrieval system