KEGG   Nasonia vitripennis (jewel wasp): 100115310Help
Entry
100115310         CDS       T01081                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100115310
   01230 Biosynthesis of amino acids
    100115310
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100115310
   00030 Pentose phosphate pathway
    100115310
   00051 Fructose and mannose metabolism
    100115310
   00052 Galactose metabolism
    100115310
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    100115310
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100115310
Protein phosphatases and associated proteins [BR:nvi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100115310
Messenger RNA biogenesis [BR:nvi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100115310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
5
AA seq 788 aa AA seqDB search
MDEEQVAHRFIKPGSHRGKGLAVFTSGGDSQGMNAAVRAVVRMGIYLGCKVFFIREGYQG
MVDGGDNIVEANWSSVSCIIHRGGTVIGSARCMEFREREGRKRAAKNLVTRGISNLCVIG
GDGSLTGANLFKEEWADLLKELVKDGEITLEQSEKYKHLHIVGLVGSIDNDFCGTDMTIG
TDTALHRIIESIDAIASTAYSHQRTFIMEVMGRHCGYLALVAAMCSEADYVFIPEWPPEQ
DWPNKLCKKLIQERLTGQRLNIIIVAEGALDRNGDPITAEKVRQVVVEKLQQDTRITVLG
HVQRGGNPSAFDRVLGCRMGAEAVMALVEATPETEACVVTLDGNQAVRLPLMECVRRTKA
VAQAMADKNWDLAVQLRGKGFVRNLETYKMLTRLKAPVEIDPNKDHYTLAVMHVGSPSCG
MNAAVRSFVRNCIYRGDKVYGIMDGVLGLATGKLKLMDWPSVTGWVAQGGAYLGTKRAPP
KDDQLPLIAQKLKEFGIQALLIIGGFEGFQTGLSFYNARTQHPEFRIPIAMIPATISNNV
PGTEFSLGCDTALNEITEICDRIRQSAQGTKRRVFIIETMGGFCGYLATLAGLAGGADAA
YIFEEKFNIKDLNQDIIAMAAKMSEGVQRGLILRNESANSNYNTEFMQRLFTEEGKGLFS
CRMNIIGHMQQGGSPTPFDRNLGTKMGAKAVEWFTERLKKDTTADGQAVSNSDESAVMLG
IVRRQYRYTPFSKLIDTTDFEHRIPTYQWWMKLRPLLKVLAKHESTYEEEGLYITVEEMD
KNNDAPLV
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggacgaagaacaggtggcccacaggtttattaaacctggcagtcacagagggaaaggc
cttgctgtttttaccagtggtggcgattctcagggtatgaatgctgctgtccgtgctgtt
gttcgcatgggcatctacttagggtgcaaagttttcttcattagagaaggttaccaagga
atggtggacggtggtgacaatatcgttgaggccaactggtcctctgtgtcttgcatcatc
catcgtggtggcacggtgatcggctcggcccgttgcatggaattccgagagcgtgaaggt
agaaagagggcggccaagaatttggtgacacgcggtatatccaacttgtgcgtcattggt
ggagacggctctctgaccggtgccaatctcttcaaagaagaatgggccgatctgttgaaa
gaattggtgaaagatggcgaaatcacactggagcaaagcgaaaaatacaagcatttgcac
atcgtcggtctggttggctcgatcgacaatgacttttgcggaacggatatgaccatcggt
acggacaccgcgctacacaggatcatcgaaagcatcgatgccatcgccagtactgcctac
tcgcaccagcgtaccttcattatggaagtaatgggccgtcattgcggctatctggctctg
gtggcagctatgtgtagcgaagcagactatgttttcatcccagaatggccgccggagcag
gattggccgaacaagctctgcaaaaagttgattcaggagcggctgacgggtcagaggctg
aacatcatcatcgtggctgagggtgccctcgacagaaacggtgaccccatcaccgctgag
aaggtgcgccaggtcgtcgtcgagaagcttcagcaggacacgagaatcacggttctcggc
cacgtccaacgcggtggcaatccctcggccttcgatcgcgttctcggctgccgtatgggt
gccgaggccgtgatggcactggttgaggcgacccccgaaacggaagcctgcgtcgtaaca
ttggacggcaaccaggccgtacggctgcctctgatggaatgcgtacggcgcaccaaggct
gtggcccaggctatggctgacaagaactgggacttggctgtacagctacgtggaaagggc
ttcgtccgaaacctcgagacctacaagatgctaactcggctcaaagctcccgtcgaaatc
gaccccaacaaggaccattacacattggcggtgatgcacgtcggttcgccgtcatgcggc
atgaacgccgctgtgcgttctttcgtgagaaactgcatttaccgcggtgacaaggtatac
ggtattatggacggtgttctgggcttggcgacgggcaagttgaagctcatggattggccc
tcggtgacgggttgggtcgctcagggtggcgcctatctgggtactaaacgagccccaccc
aaggacgatcaacttcctctaatcgctcagaaactgaaggagtttggaattcaggctctt
cttataattggtggtttcgagggatttcaaaccggtcttagtttctacaacgccagaact
cagcacccagaatttcgcatccccattgccatgattcctgccactattagtaacaatgtt
ccgggaaccgagttttctctgggttgtgatacagctctcaatgaaattaccgagatttgc
gaccgtatcaggcagtcggctcagggtacaaagcgccgcgtttttatcattgaaactatg
ggcggattttgcggttatcttgccaccctggcgggactggcaggtggtgccgacgcggcc
tacattttcgaggaaaaattcaacatcaaggatcttaaccaagatatcatcgcgatggct
gccaaaatgtccgagggagtgcagcgcggtctaattctgcgtaatgagagtgccaactcg
aattacaataccgagttcatgcaaaggctcttcaccgaagagggtaaaggacttttcagc
tgcagaatgaatataatcggtcacatgcagcaaggtggttcgcccactccgtttgatcgt
aatttgggcactaagatgggagccaaggctgtcgaatggtttacagagcgattgaagaag
gataccacagccgatggacaggcggtttctaatagcgacgagagtgccgtaatgctgggt
attgtcagacgtcagtacagatatacgccgttcagcaaactaatcgataccactgatttc
gagcacagaatccctacatatcagtggtggatgaaactgcgtccactgctcaaagtattg
gcaaagcatgagtcgacctacgaggaagagggtctctacatcacggtcgaggaaatggac
aagaacaatgacgcaccgctagtttaa

DBGET integrated database retrieval system