KEGG   Nasonia vitripennis (jewel wasp): 100115387Help
Entry
100115387         CDS       T01081                                 

Definition
protein disulfide-isomerase A3
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100115387
Enzymes [BR:nvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100115387
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100115387
  Exosomal proteins of colorectal cancer cells
   100115387
  Exosomal proteins of bladder cancer cells
   100115387
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
3
AA seq 498 aa AA seqDB search
MVGKYLALFGLALVASTGTWAAEEDVFEWGDGDFAEELRRHDNTLVMFYAPWCGHCKRLK
PEYAKAAELLRGSDPPITLAKVDCTEAGKDTCNKYSVSGYPTLKIFAKDELVNDYNGPRE
AAGIAKYMRGQVGPASKELKTLAAFEEFLNSDEISVVGFFEKDDSPLSAAFHNVAKKLRE
KVRFGHTIAKEVLEKEGLENNIVIFRPKVLQNKFEPSKQVYEGGDSISEVSAFIKQNYYG
LVGVRTRDNAGEFKNPLIVAYYAVDYVKNPKGTNYWRNRIMKVAKDFAKEYDYTFAISSK
DEFQHELNEFGIDFVKGDKPVILARDERNQKFALQEEFSLEAFEIFLNDLQAGSLEPYQK
SEPIPEDNSGSVKVAVAKNFDEVVTNNGKDTLIEFYAPWCGHCKKLALIFDELGDKLVDE
DVEIVKFDATANDVPQPYEVRGFPTLFWVPKDSKDSPVKYEGGRDLDDFVKYIAKHATNP
LKGYDRSGKPTKAPQDEL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggtaggcaagtacctggcgctcttcggcctcgcgctcgtcgcgagcaccggcacctgg
gccgccgaggaggacgtcttcgaatggggcgacggcgactttgccgaggagctccggcgc
catgataacacgctcgtcatgttctacgcgccctggtgcggacactgcaaacgcctgaag
cccgagtacgccaaggccgccgaactgctgaggggcagcgatccgcccatcaccctggcc
aaggtcgactgtacggaagctggcaaggacacgtgcaacaagtactccgtcagtggctac
ccgactctcaagatcttcgccaaagacgagctggtcaacgactacaatggaccaagggag
gctgccggtattgccaagtacatgaggggtcaagttggaccagcctcgaaggagctcaag
actcttgctgccttcgaagaattcttgaacagcgatgaaatcagcgttgttggattcttc
gagaaggatgactccccgctgtctgctgccttccacaacgttgctaagaagctcagagag
aaggtcagatttggacacactatcgccaaggaagttcttgaaaaggaaggactcgagaac
aacatcgtcattttccggcctaaagttctacaaaataaatttgagcctagcaaacaggtt
tacgaaggcggagattccatctcggaagtcagcgcgttcatcaaacaaaactactacggt
ctcgttggcgttcgtacgcgtgacaacgctggcgagttcaagaaccccctgatcgtcgcc
tactacgccgttgactatgttaagaatccaaagggcaccaactactggcgcaaccgcatc
atgaaggtggccaaggacttcgcgaaggaatacgactacacgtttgccatctcgtccaag
gatgagttccaacacgaactcaacgagtttggcatcgacttcgtcaagggcgacaagccc
gtcattctcgctcgcgacgagcgcaaccagaagttcgctctccaagaagagttcagtctt
gaggcctttgaaatcttcctcaacgacttgcaggctggatctcttgagccctaccagaaa
tctgagcctattcccgaggacaactctggtagcgtcaaagtagcagttgccaagaacttc
gacgaggtcgtgacgaacaatggcaaggacacgcttatcgagttctacgctccatggtgt
ggacactgcaaaaaacttgctctcatcttcgatgaattgggtgacaagctcgtcgatgag
gacgtagagatcgtcaagttcgacgcgaccgccaacgacgttccgcagccctacgaggtt
cgcggtttccctacgctgttctgggtgccaaaggattcgaaggatagtccagttaagtac
gagggtggccgagatcttgacgattttgtcaagtacattgccaagcacgctaccaatcct
ctgaagggatacgatcgcagcggaaaaccgaccaaggccccacaagacgagctgtaa

DBGET integrated database retrieval system