KEGG   Nasonia vitripennis (jewel wasp): 100115388Help
Entry
100115388         CDS       T01081                                 

Gene name
Tm1
Definition
tropomyosin 1
Orthology
K10373  
tropomyosin 1
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100115388 (Tm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
4
AA seq 283 aa AA seqDB search
MDAIKKKMQGMKLEKDNAMDRALLCEQQARDANARAEKAEEEARALQKKIQTIENELDQT
QEALMQVNAKLEEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA
DESERARKILENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE
ERAEAGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE
FAERSVQKLQKEVDRLEDELVHEKEKYKYICDDLDLTFTELVG
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgatcaagaagaagatgcagggaatgaagctggagaaggacaatgcgatggac
cgcgcattgctttgcgaacagcaagcccgcgacgccaacgcgcgcgctgaaaaggccgag
gaggaggcccgcgcactccagaagaagatccagaccatcgaaaatgagctcgaccagacc
caggaggcgctcatgcaggtcaacgccaagctcgaggagaaggacaaggccctccagaac
gctgagtccgaggttgccgctctcaaccggcgcatccagctgctcgaggaggacctcgag
agatccgaggagcgtttggctactgccaccgccaagctcgccgaagcctctcaggctgcc
gatgagagcgaacgcgcccgcaagatcctcgagaaccgcagcttggcggacgaggagcgc
atggatgccctggaaaatcagctgaaggaagctcgtttcctcgcagaagaggccgacaag
aaatacgatgaggtcgcccgtaaattggccatggtcgaagctgatctggagcgtgccgag
gagcgtgccgaggctggcgagtcgaaaatcgtcgaactggaggaggagctgcgcgtcgtc
ggcaacaacctcaagtctctcgaggtctcagaagagaaggcaaaccaaagggaggaagaa
tacaagaaccaaattaaaactctgaccacccgtctaaaggaggctgaagctcgtgctgag
ttcgctgagagatccgtgcagaagctccagaaggaggtcgacaggctcgaagacgaactc
gtccacgagaaggagaagtacaaatacatctgcgacgatttggatctcactttcaccgaa
ttggttggttaa

DBGET integrated database retrieval system