KEGG   Nasonia vitripennis (jewel wasp): 100115545Help
Entry
100115545         CDS       T01081                                 

Definition
probable histone acetyltransferase MYST1-like
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100115545
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
3
AA seq 423 aa AA seqDB search
MAEQPEPHHHHHLRGKDQPTSPQQANSGGVKQDSSGATTGTSANNAPTTTTTATTTTTTT
TSSTMHSNGGGKGSGDDADSLEELPLDVGEHYLVRRSADGTWHPAEIIQTRFNEIESFYE
YYVHYEGYNRRLDEWVPRDRIMCSRFDMSERTWKNGDRNQSMDLLADSSDRKITRNQKRR
HDEINHVQKTYAEMDPTTAALEKEHEAITKVKYIDKIQIGKYEIDTWYFSPYPEEYGKQP
KLWICEYCLKYMRLEKTYRYHMSECTHRQPLGKEIYRKGTLSIWEVDGKEHKIYCQNLCL
LAKLFLDHKTLYFDVEPFLFYILCEVDKHGAHLVGYFSKEKESPDGNNVACILTLPPFQR
QGYGKLLIAFSYELSRIEQTVGSPEKPLSDLGKLSYRSYWSWILLEILRDFRGTLSIYLQ
SND
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcaacccgagcctcaccatcaccaccatcttcggggcaaggatcagcctacc
tcgccgcagcaggctaacagcggcggcgtcaagcaagacagcagcggcgccactaccggg
acgagcgccaacaacgcgccgacgacgacgacgaccgcgactactacgactactacgacg
acgtcgtcgacgatgcactcgaacggtggaggcaagggctcgggcgacgacgccgacagc
ctcgaggagttgccgctcgatgtcggcgaacactacctcgtgcgcagatccgcagacggc
acctggcatcctgctgaaatcatccaaactcgatttaatgaaatcgaaagcttttatgaa
tattacgttcactacgaaggctacaatagaagattggatgagtgggtacccagagacaga
atcatgtgtagcaggttcgatatgagtgaacgtacttggaagaacggggacaggaaccag
agtatggatttgctggctgattcatcggatagaaagattactaggaatcaaaagagaaga
cacgatgaaattaatcatgtacaaaagacatatgctgaaatggatccaactactgctgca
ttagaaaaagagcacgaagccatcacaaaagtaaaatacatcgacaagatacaaatagga
aagtatgaaatagatacttggtacttcagcccttatccagaagaatatggaaaacaacca
aaactttggatctgtgaatattgccttaaatatatgagattagagaaaacatacagatac
cacatgagtgaatgcacacatagacaacctcttggaaaagaaatttaccgaaaaggaacg
cttagtatttgggaagtcgacggcaaagaacataaaatttactgccagaatctttgtctt
ctagcaaaattatttttagatcacaagacgctatacttcgatgttgaaccttttcttttt
tatattttatgtgaagttgacaaacatggagcccatctcgtcggttacttttcaaaggaa
aaagaatcgcctgatggtaacaatgttgcatgtattttaacactacctccatttcaaaga
caaggatatggcaaacttctaatagcctttagttatgagcttagtagaattgagcaaacg
gtcggaagtccagaaaaaccgttaagtgatttaggaaagctgtcttatcgaagttactgg
agttggatacttttagaaattctgagggattttaggggtacattgagtatttatttacag
tcaaatgactag

DBGET integrated database retrieval system