KEGG   Nasonia vitripennis (jewel wasp): 100115590Help
Entry
100115590         CDS       T01081                                 

Definition
ribokinase-like
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100115590
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     100115590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
4
AA seq 309 aa AA seqDB search
MSNTIAVVGSCMIDFITYSSRLPKIGETLIGNKYEQGFGGKGANQCVTAARLGASTVFVT
SLGSDSLGKEYLEKLKTENVDVTHVKLQNNIHSGIAQIIVTETGENVIVIVPGANALLSP
KDVVEAKEKIQAASVLVCQFEASLEATLEALKLYKGHGISIVNGAPAVKSVHPDILKLAD
IFCVNETEAELITGIDHLMLKNAQDAVDKLFSLGCNTVIITFGAQGAIHASQSQKKFVHT
PAEVVKAVDTTGAGDAFIGALAYFLAYHKDLPLEESIKRANKIAAQSVLKSGTQTSLPYR
KDIPATLFE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatacaattgctgtggttggatcttgcatgattgacttcatcacatattcatct
cgtttgccaaaaattggagaaactttaattggaaacaagtatgagcaagggtttggtgga
aaaggagcaaatcaatgtgtgactgcagctagactgggagcatccacagtatttgttact
tcattgggatcagattcacttggaaaagaatatttagagaaactaaaaacagagaatgtt
gatgttactcatgtaaaattacaaaataatattcattctggtattgctcaaatcatagtt
acagaaacaggagaaaatgtgatagtgattgtcccgggagccaatgcactcttatctcca
aaagacgtagtggaggccaaggagaaaattcaagctgcatctgtactcgtttgtcagttt
gaagcatcattagaagctacattagaagcattaaaactatacaaaggacatggtatatca
attgttaatggtgcaccagctgtgaaaagtgtccatccagatattttaaaattagctgac
atattttgtgtcaacgaaacagaagcagaacttataactggaatagatcacttgatgttg
aagaatgctcaagatgctgtggacaaattgttctccctaggctgcaatacagttattatt
acatttggagcccaaggagccattcatgcatctcagagccagaagaaatttgtacataca
ccagcggaggttgtaaaggctgttgatactactggagctggagatgctttcataggagca
cttgcttacttcttagcataccacaaagatcttccattagaagagtccataaaaagggca
aataaaatagccgcacagagtgttttgaaatcaggaacacaaaccagtttgccgtacagg
aaggatattccagctacactttttgaatga

DBGET integrated database retrieval system