KEGG   Nasonia vitripennis (jewel wasp): 100115643Help
Entry
100115643         CDS       T01081                                 

Definition
uncharacterized LOC100115643
Orthology
K06091  
MAGUK p55 subfamily member 5
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Environmental Information Processing
  Signal transduction
   04391 Hippo signaling pathway -fly
    100115643
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
5
AA seq 1612 aa AA seqDB search
MSKASPLAKDDLEPVRRRARDRSRLSSLLGRISWCGCAAESRIPSRPKSPDSAGSVLDLE
TGDDVARHFDLSSIKFIDDDDDDEADGREERSLLISDSSEVLDGPNAGGIRDAWVIAVER
AWSREIDADSLRPLDALRAMRILKTLHWSRSRTTPQHQQQQQQQHQQQHQQQQQQEAGGQ
SKEPAGPDEMWAPGFLGHHRELPVDVPDSLLQTAAYPNKDPFRICSDDEDEIKKNENEDE
EDVEVDEIELELEVDTCSRFTGHKESSVDADEDYPFAKEDYPTMLKTCSDESASPRSSSG
SSDSTVPLDASLVVGIAPARTVQPQLAQIFASSTSFDNPAYGLSDLQDLRDFENFVMSRP
EQLGDFALLIGEQGLDKLHHQHQHQHQHQHQHQHQHHNNNNVKNGDDDKGAASNVTAVAA
TSTGAASCNVKASGSKKKKHSTGHKGPETEGLLRTGSRDELLQSVEQLSSMPRMRKSNKQ
QQSSSGYSTLRSERSTDFDQVDHAPFLVVGAGKSYREVAVDCPADFVPVTKSHPVYPPPG
TLDSRSAAAKHAKSSKDKSNKRNDCEKEKENERPIDANALECPSRKVRSSSKVRSLLIEG
LQTLKLGAPRLPEQQQQQQQQQQQQRRQRQQQQLRSNNRFDSCTRTSIRARTHIHAHAIS
IESLQLNESLSKSFVFSSVKNSINKSKSKSKSRENLVEAVDRCQQDEKPGVRLGLAHEQP
EFIEEHNQNSRNSLRQRSRRFFSTEESPNTQNQNNSRLSLAYRRSKRFDVLKDVEVRRLL
SKSELDLSSSLGDSLQPRLLPPCLSDTQISFSRANSQFVHIDDEKVGAETKGLITEAREL
GADEQEDVKLGTKAGLNGVKPAIPPRDQKRAPARPPKDNLRNCAQNNNVEESDMPPPPPP
ALPPSTAAAAQLKSEHTPQQLHSLHKYQEELWKRKDEEERQEYQNRSLRYSQKLQALESR
TVSLSGQENLGYSQDEFGPSVAKQQQPASEPVEEPVRPLTYGEVVASLERLQLQLRNISG
SLGISGPGVEAELEAVRTLLLQKRFATALSTHHALKARLRSGKSLKLHTDDASSLARDCV
EVLEQWSQQQATQASSAETIAAAEELQALLTSYEMEGLLLAHDSAITRVEGLQRTAAGYS
DSPGSQQSGQRAGSPFASSREARLAAAADTIKIIKIEKTNEPLGATVRNEGDAVIIGRVV
RGGAADKSGLLHEGDEVLEVNGVEMRGKSVNDVCDILAGMQGSLTFHILPAPTTQRNSNL
NGAREDAQQIHTVRAHFDYDPEEDPYIPCRELGVGFQKGDVLHVISQEDPNWWQAYREGE
EDQALAGLIPSRAFQHQRESMKQTIAGDKSTVRGAKKSSTLLCARKNPKKKKRSKFGSNL
NDDGYPLYATTSIDDYDSEEVLTYEEVALYYPRADHKRPIVLIGPPNIGRHELRQRLMQD
SEKFAAAIPHTSRPRKDTEVDGQDYHFISRQQFESDILCRKFVEHGEYEKAYYGTSVEAI
RTVVNSGKICVLNLHPQSLKILRNSDLKPYVVFVAPPSLEKLKQKRIKNNETYKEEELKD
IIEKAREMEDKYGHLFDMIIINNDTDRAYNQLLTEINSLEREPQWVPATWVQ
NT seq 4839 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggcgtcgccgctggcgaaagacgacctggagcccgtgcgtcgccgcgctcgg
gacagatctcggctctcctcgctcctcgggcgtatttcctggtgcggctgcgccgcggag
tcgcgcatccccagcaggcccaagtcgcccgactcggccggcagcgttctcgacctcgag
accggggacgatgtcgcgcgtcactttgacctctcctccatcaagttcatcgacgacgac
gacgacgacgaggccgacggcagggaagaaaggagtctgctcatttcggacagctctgaa
gtattggacggaccaaatgccggagggatcagggatgcatgggtcatcgctgtggagaga
gcttggtcgagagaaatcgacgcggactcgcttcgcccgctggacgctctgcgcgccatg
aggattctcaaaacgctgcactggtcgcgcagccgaaccaccccgcagcaccagcagcag
cagcagcagcagcaccagcagcagcaccagcagcagcagcagcaagaggcgggaggccag
tccaaggagcctgcgggccccgatgagatgtgggccccgggcttcctgggccaccaccgg
gagctgcccgtcgacgtgcccgattccctgctccagacggcggcctaccccaataaggac
cccttcaggatttgctctgacgacgaggacgagattaagaagaacgagaacgaggacgag
gaagacgtcgaggtcgacgaaatcgaactcgagctcgaggtcgatacctgcagcagattt
accggccacaaggagtcgagcgtcgacgctgacgaggactatcccttcgccaaggaggac
tacccgacgatgctcaagacctgcagcgacgagtcggcgagtccgaggagctcgtccggc
agttccgacagcacggtccccctcgacgccagtctcgtcgtcggcatcgccccggcccga
acggtgcagccccagctcgctcaaatcttcgccagcagcacctccttcgacaatcccgcc
tacggtctctcggatctccaggacctccgggactttgagaactttgtcatgagcaggccc
gagcagctcggcgatttcgccctgctgatcggcgagcagggcctcgacaagctccaccat
cagcaccagcaccagcaccagcaccagcaccagcaccagcaccagcaccacaacaacaac
aacgtcaagaacggcgacgacgacaagggcgcagccagtaacgtaaccgccgtggccgcc
acgagtaccggcgccgccagctgcaacgtaaaagcaagtggcagcaaaaagaagaagcac
agtacgggccacaaggggcccgagaccgagggactgctgcgaacgggctcgagggacgag
ctgcttcagagcgtagagcagctctcctctatgccgcgtatgcgcaagagcaacaagcag
cagcagtcgtcgagcggctactcgaccctcaggagcgaaaggtcgaccgatttcgatcag
gtcgaccacgcgcccttcctcgtcgtcggggctgggaagagctaccgcgaagtggctgtc
gactgtccagcggatttcgtaccggtgaccaagagccatccggtttatccgccgccaggc
acgctcgactcgagaagtgccgccgcaaagcacgcgaaaagctcaaaagacaaaagcaat
aagcgaaacgactgcgagaaggaaaaggagaacgagcggccgatagatgcaaacgcgctc
gagtgtcccagcaggaaggtaaggtcgagctcgaaggtccgcagcttattgatcgagggc
ttgcaaactctaaaacttggcgcaccgcggctacccgagcagcagcagcagcagcagcag
cagcagcagcagcaacggcggcagcggcagcagcagcagctgcgatccaacaatcgcttt
gactcttgcacccgcactagcattcgcgcacgcacgcacattcacgctcacgctatctcg
atcgagtccttgcaactgaacgagagcctctccaagtccttcgtcttctcctcggttaag
aattcgataaataaatctaaatcaaagtccaagtctcgcgagaacctggtcgaggcggtg
gatcggtgtcagcaggacgagaagccgggagtacgcctcgggctggcgcacgagcagccc
gagttcatcgaggagcacaaccagaactcgaggaattctctgaggcagcggagccggcga
ttcttctctaccgaggaatcgcccaacactcagaatcagaacaactcgaggctctcgttg
gcctatcggcgctcgaagcgcttcgacgtcctcaaggacgtcgaggtgcgtcggctgctc
tcgaaaagtgaactcgatctctcaagctccttgggcgactctctgcaaccgagactcctg
cccccttgcctctctgacacgcaaattagcttctctcgcgctaatagtcaattcgttcac
atcgatgatgagaaagtaggcgcggagacgaagggcttgattaccgaggctcgcgaactg
ggcgccgacgagcaggaggacgtcaaacttggcacgaaggccgggctgaacggcgtgaag
ccggcgataccaccgagggatcagaagcgcgccccggcccgtccacccaaagataatctg
cggaactgcgcccagaacaacaatgtcgaggagagcgacatgccgccgccgccgccgccg
gccctgccgccctcgacagcggctgctgcccagctcaagagcgagcacacgccgcagcag
ctacattccctgcacaagtatcaggaggagctatggaagcgcaaggacgaggaggagcgt
caagagtaccagaatcgctcgttgcgttactcgcaaaagctccaggctctcgagagccgc
accgtcagcctctctggccaagagaacctcggctacagtcaggacgagttcggcccttcc
gtcgcaaagcagcagcaaccagccagtgaaccagtcgaagagcccgtcagaccactcacc
tatggcgaggtcgtggcgagcctcgagaggctgcagctccagctgcgaaacattagcggc
agcctcggcatcagcggcccgggggtcgaggctgagctggaggccgtcaggacgctgctg
ctccagaagcgtttcgccaccgccctctcgacccaccacgcgctcaaggcccgactgcgc
tccggcaagagtctcaaacttcacaccgacgatgcctccagcctcgccagagactgcgtc
gaggtgctcgagcagtggagccagcagcaggcgacacaggccagctctgccgagacgata
gccgcggccgaggagctgcaggccctgctcaccagctacgagatggagggactgctgctc
gctcacgactcagcgataactcgggtcgagggactacagcgtaccgcagccggatacagc
gacagtcctggatcccagcagagcgggcaacgagctggcagccccttcgccagctctcga
gaggccagactggccgccgctgcggacacaatcaaaatcatcaagatcgaaaagacaaac
gagccgctcggcgctactgtcagaaacgaaggcgacgctgtcattatcggtcgagtggta
cggggaggtgctgccgataaatccggcctgctacacgagggcgacgaggtgctcgaggtc
aatggtgttgagatgcgtggcaaaagcgtcaatgacgtctgtgacatactcgcgggtatg
cagggaagtctcaccttccacatactgccagccccgacgacgcagcgcaacagcaatctc
aatggtgctcgtgaagacgctcaacaaattcacactgtgcgggctcatttcgattacgac
ccagaggaggatccctacattccttgtagagaactaggcgtgggctttcaaaaaggcgat
gtgctacatgtcatctcacaagaggatcccaactggtggcaggcttatcgagaaggtgaa
gaggaccaagcgcttgccggcttgattccaagcagagcgtttcagcatcagcgtgaatcg
atgaagcagacaatagctggggacaagtcgacggtacgaggagcaaaaaaatctagcaca
ctactttgtgcgagaaaaaatcccaagaaaaagaagagaagtaaatttggctcgaacttg
aatgacgatgggtatcctctttacgccaccacttctattgacgattacgatagcgaggag
gtattaacatacgaagaagtggccttatactatcctagagcagaccataaaaggccaatc
gtacttataggcccgcctaatattggtagacacgagctcagacaacgacttatgcaagac
agcgaaaaatttgcagcagcgataccacatacaagtcgaccgcgcaaagataccgaagtc
gatggtcaagattatcactttatctcgcgacagcagtttgaatccgacatcctctgtcgc
aagtttgtggaacatggcgagtacgagaaagcctactacggcacttctgttgaagccatc
cgtacggtagtcaactcgggtaaaatctgcgttcttaatcttcatccacagtccctgaaa
atcctacggaactcggacctcaagccctacgtcgtctttgtcgcgccgccaagtcttgaa
aagctcaaacaaaaaagaataaaaaataatgagacttacaaggaagaggagctcaaggac
ataatagaaaaggccagagaaatggaggacaaatatggtcatcttttcgatatgatcatc
attaacaacgacacggatcgtgcgtacaatcagctgcttacagaaataaattcgctcgaa
agagaacctcagtgggtgccagcaacctgggtgcaatag

DBGET integrated database retrieval system