KEGG   Nasonia vitripennis (jewel wasp): 100115643Help
Entry
100115643         CDS       T01081                                 

Definition
uncharacterized LOC100115643
Orthology
K06091  
MAGUK p55 subfamily member 5
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Hippo signaling pathway - fly
Class
Environmental Information Processing; Signal transduction; Hippo signaling pathway -fly [PATH:nvi04391]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
1
AA seq 1522 aa AA seqDB search
MRILKTLHWSRSRTTPQHQQQQQQQHQQQHQQQQQQEAGGQSKEPAGPDEMWAPGFLGHH
RELPVDVPDSLLQTAAYPNKVIEKVDSVATVCQSAEPQSPPSREPAPAAPLSASRISLDA
HFISANEKRILEENSAFIIQEHMVKDPFRICSDDEDEIKKNENEDEEDVEVDEIELELEV
DTCSRFTGHKESSVDADEDYPFAKEDYPTMLKTCSDESASPRSSSGSSDSTVPLDASLVV
GIAPARTVQPQLAQIFASSTSFDNPAYGLSDLQDLRDFENFVMSRPEQLGDFALLIGEQG
LDKLHHQHQHQHQHQHQHQHQHHNNNNVKNGDDDKGAASNVTAVAATSTGAASCNVKASG
SKKKKHSTGHKGPETEGLLRTGSRDELLQSVEQLSSMPRMRKSNKQQQSSSGYSTLRSER
STDFDQVDHAPFLVVGAGKSYREVAVDCPADFVPVTKSHPVYPPPGTLDSRSAAAKHAKS
SKDKSNKRNDCEKEKENERPIDANALECPSRKVRSSSKVRSLLIEGLQTLKLGAPRLPEQ
QQQQQQQQQQQRRQRQQQQLRSNNRFDSCTRTSIRARTHIHAHAISIESLQLNESLSKSF
VFSSVKNSINKSKSKSKSRENLVEAVDRCQQDEKPGVRLGLAHEQPEFIEEHNQNSRNSL
RQRSRRFFSTEESPNTQNQNNSRLSLAYRRSKRFDVLKDVEVRRLLSKSELDLSSSLGDS
LQPRLLPPCLSDTQISFSRANSQFVHIDDEKVGAETKGLITEARELGADEQEDVKLGTKA
GLNGVKPAIPPRDQKRAPARPPKDNLRNCAQNNNVEESDMPPPPEHTPQQLHSLHKYQEE
LWKRKDEEERQEYQNRSLRYSQKLQALESRTVSLSGQENLGYSQDEFGPSVAKQQQPASE
PVEEPVRPLTYGEVVASLERLQLQLRNISGSLGISGPGVEAELEAVRTLLLQKRFATALS
THHALKARLRSGKSLKLHTDDASSLARDCVEVLEQWSQQQATQASSAETIAAAEELQALL
TSYEMEGLLLAHDSAITRVEGLQRTAAGYSDSPGSQQSGQRAGSPFASSREARLAAAADT
IKIIKIEKTNEPLGATVRNEGDAVIIGRVVRGGAADKSGLLHEGDEVLEVNGVEMRGKSV
NDVCDILAGMQGSLTFHILPAPTTQRNSNLNGAREDAQQIHTVRAHFDYDPEEDPYIPCR
ELGVGFQKGDVLHVISQEDPNWWQAYREGEEDQALAGLIPSRAFQHQRESMKQTIAGDKS
TVRGAKKSSTLLCARKNPKKKKRSKFGSNLNDDGYPLYATTSIDDYDSEEVLTYEEVALY
YPRADHKRPIVLIGPPNIGRHELRQRLMQDSEKFAAAIPHTSRPRKDTEVDGQDYHFISR
QQFESDILCRKFVEHGEYEKAYYGTSVEAIRTVVNSGKICVLNLHPQSLKILRNSDLKPY
VVFVAPPSLEKLKQKRIKNNETYKEEELKDIIEKAREMEDKYGHLFDMIIINNDTDRAYN
QLLTEINSLEREPQWVPATWVQ
NT seq 4569 nt NT seq  +upstreamnt  +downstreamnt
atgaggattctcaaaacgctgcactggtcgcgcagccgaaccaccccgcagcaccagcag
cagcagcagcagcagcaccagcagcagcaccagcagcagcagcagcaagaggcgggaggc
cagtccaaggagcctgcgggccccgatgagatgtgggccccgggcttcctgggccaccac
cgggagctgcccgtcgacgtgcccgattccctgctccagacggcggcctaccccaataag
gtaatagagaaagtagactcggtggctactgtctgtcagagtgccgagccgcagtcaccc
cccagccgcgagccagcaccagccgctccccttagcgctagccgcatctccctagacgct
cactttataagcgcgaacgagaaacgcatactcgaggagaattccgcattcataattcaa
gagcacatggtcaaggaccccttcaggatttgctctgacgacgaggacgagattaagaag
aacgagaacgaggacgaggaagacgtcgaggtcgacgaaatcgaactcgagctcgaggtc
gatacctgcagcagatttaccggccacaaggagtcgagcgtcgacgctgacgaggactat
cccttcgccaaggaggactacccgacgatgctcaagacctgcagcgacgagtcggcgagt
ccgaggagctcgtccggcagttccgacagcacggtccccctcgacgccagtctcgtcgtc
ggcatcgccccggcccgaacggtgcagccccagctcgctcaaatcttcgccagcagcacc
tccttcgacaatcccgcctacggtctctcggatctccaggacctccgggactttgagaac
tttgtcatgagcaggcccgagcagctcggcgatttcgccctgctgatcggcgagcagggc
ctcgacaagctccaccatcagcaccagcaccagcaccagcaccagcaccagcaccagcac
cagcaccacaacaacaacaacgtcaagaacggcgacgacgacaagggcgcagccagtaac
gtaaccgccgtggccgccacgagtaccggcgccgccagctgcaacgtaaaagcaagtggc
agcaaaaagaagaagcacagtacgggccacaaggggcccgagaccgagggactgctgcga
acgggctcgagggacgagctgcttcagagcgtagagcagctctcctctatgccgcgtatg
cgcaagagcaacaagcagcagcagtcgtcgagcggctactcgaccctcaggagcgaaagg
tcgaccgatttcgatcaggtcgaccacgcgcccttcctcgtcgtcggggctgggaagagc
taccgcgaagtggctgtcgactgtccagcggatttcgtaccggtgaccaagagccatccg
gtttatccgccgccaggcacgctcgactcgagaagtgccgccgcaaagcacgcgaaaagc
tcaaaagacaaaagcaataagcgaaacgactgcgagaaggaaaaggagaacgagcggccg
atagatgcaaacgcgctcgagtgtcccagcaggaaggtaaggtcgagctcgaaggtccgc
agcttattgatcgagggcttgcaaactctaaaacttggcgcaccgcggctacccgagcag
cagcagcagcagcagcagcagcagcagcagcaacggcggcagcggcagcagcagcagctg
cgatccaacaatcgctttgactcttgcacccgcactagcattcgcgcacgcacgcacatt
cacgctcacgctatctcgatcgagtccttgcaactgaacgagagcctctccaagtccttc
gtcttctcctcggttaagaattcgataaataaatctaaatcaaagtccaagtctcgcgag
aacctggtcgaggcggtggatcggtgtcagcaggacgagaagccgggagtacgcctcggg
ctggcgcacgagcagcccgagttcatcgaggagcacaaccagaactcgaggaattctctg
aggcagcggagccggcgattcttctctaccgaggaatcgcccaacactcagaatcagaac
aactcgaggctctcgttggcctatcggcgctcgaagcgcttcgacgtcctcaaggacgtc
gaggtgcgtcggctgctctcgaaaagtgaactcgatctctcaagctccttgggcgactct
ctgcaaccgagactcctgcccccttgcctctctgacacgcaaattagcttctctcgcgct
aatagtcaattcgttcacatcgatgatgagaaagtaggcgcggagacgaagggcttgatt
accgaggctcgcgaactgggcgccgacgagcaggaggacgtcaaacttggcacgaaggcc
gggctgaacggcgtgaagccggcgataccaccgagggatcagaagcgcgccccggcccgt
ccacccaaagataatctgcggaactgcgcccagaacaacaatgtcgaggagagcgacatg
ccgccgccgcccgagcacacgccgcagcagctacattccctgcacaagtatcaggaggag
ctatggaagcgcaaggacgaggaggagcgtcaagagtaccagaatcgctcgttgcgttac
tcgcaaaagctccaggctctcgagagccgcaccgtcagcctctctggccaagagaacctc
ggctacagtcaggacgagttcggcccttccgtcgcaaagcagcagcaaccagccagtgaa
ccagtcgaagagcccgtcagaccactcacctatggcgaggtcgtggcgagcctcgagagg
ctgcagctccagctgcgaaacattagcggcagcctcggcatcagcggcccgggggtcgag
gctgagctggaggccgtcaggacgctgctgctccagaagcgtttcgccaccgccctctcg
acccaccacgcgctcaaggcccgactgcgctccggcaagagtctcaaacttcacaccgac
gatgcctccagcctcgccagagactgcgtcgaggtgctcgagcagtggagccagcagcag
gcgacacaggccagctctgccgagacgatagccgcggccgaggagctgcaggccctgctc
accagctacgagatggagggactgctgctcgctcacgactcagcgataactcgggtcgag
ggactacagcgtaccgcagccggatacagcgacagtcctggatcccagcagagcgggcaa
cgagctggcagccccttcgccagctctcgagaggccagactggccgccgctgcggacaca
atcaaaatcatcaagatcgaaaagacaaacgagccgctcggcgctactgtcagaaacgaa
ggcgacgctgtcattatcggtcgagtggtacggggaggtgctgccgataaatccggcctg
ctacacgagggcgacgaggtgctcgaggtcaatggtgttgagatgcgtggcaaaagcgtc
aatgacgtctgtgacatactcgcgggtatgcagggaagtctcaccttccacatactgcca
gccccgacgacgcagcgcaacagcaatctcaatggtgctcgtgaagacgctcaacaaatt
cacactgtgcgggctcatttcgattacgacccagaggaggatccctacattccttgtaga
gaactaggcgtgggctttcaaaaaggcgatgtgctacatgtcatctcacaagaggatccc
aactggtggcaggcttatcgagaaggtgaagaggaccaagcgcttgccggcttgattcca
agcagagcgtttcagcatcagcgtgaatcgatgaagcagacaatagctggggacaagtcg
acggtacgaggagcaaaaaaatctagcacactactttgtgcgagaaaaaatcccaagaaa
aagaagagaagtaaatttggctcgaacttgaatgacgatgggtatcctctttacgccacc
acttctattgacgattacgatagcgaggaggtattaacatacgaagaagtggccttatac
tatcctagagcagaccataaaaggccaatcgtacttataggcccgcctaatattggtaga
cacgagctcagacaacgacttatgcaagacagcgaaaaatttgcagcagcgataccacat
acaagtcgaccgcgcaaagataccgaagtcgatggtcaagattatcactttatctcgcga
cagcagtttgaatccgacatcctctgtcgcaagtttgtggaacatggcgagtacgagaaa
gcctactacggcacttctgttgaagccatccgtacggtagtcaactcgggtaaaatctgc
gttcttaatcttcatccacagtccctgaaaatcctacggaactcggacctcaagccctac
gtcgtctttgtcgcgccgccaagtcttgaaaagctcaaacaaaaaagaataaaaaataat
gagacttacaaggaagaggagctcaaggacataatagaaaaggccagagaaatggaggac
aaatatggtcatcttttcgatatgatcatcattaacaacgacacggatcgtgcgtacaat
cagctgcttacagaaataaattcgctcgaaagagaacctcagtgggtgccagcaacctgg
gtgcaatag

DBGET integrated database retrieval system