KEGG   Nasonia vitripennis (jewel wasp): 100115692Help
Entry
100115692         CDS       T01081                                 

Definition
(RefSeq) cyclin-H
  KO
K06634  cyclin H
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi03022  Basal transcription factors
nvi03420  Nucleotide excision repair
Module
nvi_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    100115692
  Replication and repair
   03420 Nucleotide excision repair
    100115692
Transcription machinery [BR:nvi03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100115692
DNA repair and recombination proteins [BR:nvi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     100115692
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_C_2 Cyclin_N Cyclin_C TFIIB DBR1
Motif
Other DBs
NCBI-GeneID: 100115692
NCBI-ProteinID: XP_008202058
NASONIABASE: NV12880
Position
5
AA seq 348 aa AA seqDB search
MPAIPRFLFSGPSDNSFKMFPLSTQKKYWLYNDENDIAILRKEANAEFIAKHGANMPEDK
REKHFLSVSEERVLQRFYESQLKEFCKRFSPPMPKPTIATALHYFKRFYLRNSVMDYHPK
EILVTCVYLACKVEEFNVSIIQFVANIMGDREKASDIILNNELLLMQQLNYNLTVHNPFR
PVEGLLIDIKTRFPCPSNPEKLRPYIDEFLEKVFLTDSVLLYAPSQIALAAMLHAASSTN
VNLDSYVTDVLFSGEHLVAIIEAVRKIRSIAKCVELPPRDLVKTLEKKLDKCRNQDNNPD
SEVYKQRMQEMFDEEDLIDDEKYAKIVQNQADHDEKVLGVTKVSPGTT
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgccagccattcctcgattcctgttttccggcccaagcgataactcgtttaagatgttt
ccgttaagtacccagaagaagtattggctatacaacgatgaaaacgatattgccattttg
aggaaagaggctaatgccgagtttattgctaagcatggagctaatatgccagaggacaaa
agagagaagcacttcctttcggtgtcagaggaaagggtacttcaaagattttacgaatca
caacttaaagaattttgcaaaaggttcagtcctccgatgcccaaaccaacaatcgctaca
gcactgcactattttaagagattttacttgcgaaacagtgtcatggattatcatcccaaa
gaaattcttgtaacctgtgtgtacttagcttgcaaggttgaagaatttaatgtatcaata
attcagtttgtggctaatattatgggagatagggaaaaagcttctgacatcatacttaac
aatgaacttctcttgatgcaacaactaaactacaatttaactgttcacaatccattcaga
cccgttgaaggacttctgatcgatataaagacaaggtttccatgtccttctaatccagaa
aaattaaggccgtacatcgatgaatttttggaaaaagtttttctaaccgacagtgtctta
ttatacgctcccagtcaaattgcattagcggcaatgttgcatgcagcctctagtacaaat
gtcaatctagattcctatgtcacagatgtattattttcaggagaacatcttgtagcaatt
attgaagctgtgagaaaaatacgatccatagcaaaatgtgttgagttgccaccaagagat
cttgtgaaaacattggaaaagaaattggacaaatgcagaaatcaagataacaatccagac
agtgaagtttacaaacaacgtatgcaagaaatgtttgatgaagaagatttgatagatgat
gaaaagtatgctaaaatagttcaaaaccaggctgatcacgatgaaaaagttttaggagtt
accaaagtatccccgggtaccacatag

DBGET integrated database retrieval system