KEGG   Nasonia vitripennis (jewel wasp): 100115810Help
Entry
100115810         CDS       T01081                                 

Gene name
Pik3cb
Definition
phosphoinositide-3-kinase, catalytic, beta polypeptide
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100115810 (Pik3cb)
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    100115810 (Pik3cb)
   04068 FoxO signaling pathway
    100115810 (Pik3cb)
   04070 Phosphatidylinositol signaling system
    100115810 (Pik3cb)
   04150 mTOR signaling pathway
    100115810 (Pik3cb)
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100115810 (Pik3cb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
1
AA seq 1103 aa AA seqDB search
MAEDILLGERDQKLSTKMLELHYLEEARSKMVHIPNSYMYNFWIKTPTEVVELTCLMPNG
VVIPLEANRNTTLAEIKEDLWDEASKYPLHGILRDSQSYIFLCINSNAESEELRDESRRL
CDIKPFCSVLKLVEKEDTKVDRNLDSQIGLLIGKGLHEFVALKNSEVNDFRWKMRLLGDE
IALDRQKKSWTEKVLYQFPTRLAASSDIPKNIETRLKDGNIVLVVKFENADTSYTFLVPH
ATTPRQLVVLALNKRANTLTLRDERPRDFTLKVCGQEEYFLTDHPLIQFSYVQDCIAKDN
VPTLVAVNINSIPVYKDHDYEDPDSDTLNRGTRPSFSTLTLRKKGKYTYSWNIEDQFKFN
VNGISRLNCDAAHRTVEVGLQAGLFHGGKSLCESQKTKDIVVRADGSCEWEETLSFDIKV
RDIPRNTRLCCVLYEIGKTSKGIKSRKLVKDSKQEYFINPLCWANTTIYDFKSQLKTGAM
TLYTWAYAEDIQNEDLLHPLGTVVSNPHIDRAAALMLTFPSYTRDQIILYPSPEKMVEFA
TKLSESRENSAEFDPTSVSDSDLQHHIDQLQLLADRDPLHELHEQERKTIWSLRQQCIMK
VPTILTKLLQCVEWNDHKEVSEATSLVLRWPKLPVERALELLDYAYADQTVRSFAVKCLK
DVSDEDLSLFLLQLVQALKHENYLSCELTEFLLRRALNNQRIGHFLFWHLRSEMHVGSVS
VRFGLILEAYCRGSQEHMKALFKQMECLDKLGSACDQVKQRKDRKTAQQCLQDYIKEAHC
REAFYNVMSPLNPSFRWSNIKVDKCRVMDSKMRPLCLAFQNLDQYGDDIYLILKHGDDLR
QDMLTLQMLRIMDKLWKNEGLDLRMNPYGCISTDNRVGLIEVVLNADTIANIQKEKGTFP
ATAAFRRGSLLAWLKDHNHSESTLNKAIEEFTLSCAGYCVATYVLGIADRHSDNIMVKKT
GQLFHVDFGHILGHFKEKFGIRRERVPFVLTNDFVHVINKGQTKKGQALEFQRFQNYCEQ
AFLVLRRHGSLILSLFAMMISTGLPELSSEKDLNYLRDTLVLEMSEAEAQKHFRSKFDEA
LCNSWKTSLNWASHNMAKSNKPM
NT seq 3312 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagacattttattaggagaacgcgatcaaaaattatcaaccaaaatgttagaa
ttacactacctagaagaagcaagaagcaaaatggttcatatccccaatagttacatgtat
aacttttggataaaaacgccaaccgaggtcgttgaactaacatgtttgatgcccaatggc
gtggttatcccactcgaggcgaatcgcaatacaactttagcagaaatcaaagaagatctc
tgggacgaagctagtaaatacccgttacatggaatattaagggattcacagtcttatata
tttttatgtatcaattccaatgccgaatccgaagagttgcgagatgaaagcagacgtttg
tgcgatatcaaacccttttgttctgtacttaaactcgtggaaaaggaggataccaaggtc
gacaggaatttggattcgcaaatcggtctcttgataggcaaaggtttgcacgagttcgta
gctctgaaaaattcggaagtcaacgactttcgatggaagatgcgattactcggagacgaa
atcgctctagatagacaaaagaaatcttggactgaaaaagtgctctatcaatttccgact
agattagccgcttcgtccgatataccgaagaacatcgagactcgactgaaagacggaaac
atagttctcgttgtaaagttcgaaaacgctgacacatcgtatacctttttagtgccgcac
gcgacaactccacggcagctcgttgtgctggctttgaataagcgcgcgaacactctgact
ctgcgtgacgaacgtccaagagatttcacgttaaaagtctgcggccaagaggaatatttc
ttgaccgatcatccacttattcaatttagctacgttcaagattgcatcgccaaggacaat
gttccaacactcgtcgccgtcaatataaacagtatccccgtatacaaggatcatgactat
gaagatccggactccgatacactgaatcgcggtaccagaccatcgttctcgacgcttacg
ctgcgaaagaaaggaaagtacacgtattcgtggaatatcgaagatcagttcaagttcaac
gtcaatgggatttcgcggctcaattgcgacgccgcgcacagaacggtggaagttggcttg
caggctggcctgttccacggtggcaagtccctctgcgagagccaaaagacgaaggacata
gtggtccgtgccgatggcagttgcgagtgggaggagacgctgagtttcgacataaaggta
cgtgatataccgagaaatacacggctatgctgcgttctttacgaaataggcaagacgtcg
aaaggcatcaagagccgaaagctcgtgaaagattccaagcaagaatatttcataaatcca
ctgtgttgggcaaacacaactatttacgacttcaaaagtcaactaaagactggcgctatg
actctttacacgtgggcttacgctgaagacattcaaaacgaagacttgctccatcccttg
ggcaccgtcgtatccaatccccacatagatcgagcagctgccctcatgttgactttccct
agttatacaagagatcaaataattctttacccgtctccggagaaaatggtcgagttcgcc
acgaagctcagcgaatcccgagaaaattcagcggaattcgatcctaccagcgtttctgac
tcggatctgcaacatcacatagatcaactccagctgctggcagaccgagatccactgcac
gagcttcacgagcaggaaagaaaaaccatctggtcgttgaggcagcagtgcatcatgaaa
gtcccgacgatactaacgaagctgttgcagtgcgtcgagtggaacgatcataaggaagtc
tcagaagcgacttccttggtactccgctggccaaagctgcccgtcgaaagagcattggaa
ctattggattacgcttatgccgaccaaacagttcgcagtttcgccgtgaaatgcttaaaa
gacgtgagcgacgaagacctgagtctgttcctactgcaactcgtgcaggctctcaagcat
gaaaattatttgtcttgcgagctcacagagtttttgttgaggcgcgctttgaacaatcag
cggataggccactttttgttttggcatctgagatctgagatgcacgtcggctctgtatcc
gtaaggttcggtctgattttggaagcttactgccgcggcagccaggagcacatgaaagct
cttttcaaacaaatggaatgcttggacaagctcggaagcgcgtgcgatcaagtgaaacag
cgaaaagatcgtaaaaccgcgcagcagtgtctgcaagattatattaaggaggcgcattgt
cgcgaggctttttacaacgttatgagtccgttgaatccaagttttagatggagcaacata
aaggtcgacaagtgcagggtgatggacagtaaaatgaggccactttgtttggcttttcaa
aaccttgatcagtatggagacgacatatacctgattttgaagcacggcgacgatcttcgg
caagatatgctgactttgcaaatgcttcggatcatggataaactgtggaaaaacgaaggc
ttagatttgcgaatgaatccctacgggtgtatatccactgataacagagtgggtctgatc
gaagtcgttttgaatgcagataccattgccaatattcaaaaagagaagggcactttccca
gccacggcggcgttcagaagaggatcgctgctggcgtggttgaaggaccacaatcactcg
gaatcaactttaaataaagcaatcgaagaatttacattgagctgtgccggttactgtgtc
gctacctacgtacttggcatcgcggaccgacactcggacaatataatggttaaaaaaacg
ggtcaactatttcacgtggatttcggtcacatattgggtcacttcaaggaaaagttcgga
attcgaagagaaagagtgcccttcgtattgacgaacgatttcgtgcacgtaattaataaa
ggacaaactaagaaaggccaggctctagaattccagagattccaaaattattgcgagcaa
gcgtttctagtattaagacgacacggtagtcttattttgtccttattcgccatgatgatt
tctaccggcttgccagaattatcgtcagaaaaggatcttaattatctccgagatacactg
gtcctggaaatgtctgaagctgaggctcaaaaacatttccgtagcaagtttgatgaagct
ctttgcaactcttggaagacctccttgaattgggcatctcacaacatggctaagagtaat
aaaccaatgtaa

DBGET integrated database retrieval system