KEGG   Nasonia vitripennis (jewel wasp): 100115810Help
Entry
100115810         CDS       T01081                                 

Gene name
Pik3cb
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  KO
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Longevity regulating pathway - multiple species
AGE-RAGE signaling pathway in diabetic complications
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100115810 (Pik3cb)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100115810 (Pik3cb)
   04070 Phosphatidylinositol signaling system
    100115810 (Pik3cb)
   04150 mTOR signaling pathway
    100115810 (Pik3cb)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    100115810 (Pik3cb)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100115810 (Pik3cb)
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100115810 (Pik3cb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
1
AA seq 1103 aa AA seqDB search
MAEDILLGERDQKLSTKMLELHYLEEARSKMVHIPNSYMYNFWIKTPTEVVELTCLMPNG
VVIPLEANRNTTLAEIKEDLWDEASKYPLHGILRDSQSYIFLCINSNAESEELRDESRRL
CDIKPFCSVLKLVEKEDTKVDRNLDSQIGLLIGKGLHEFVALKNSEVNDFRWKMRLLGDE
IALDRQKKSWTEKVLYQFPTRLAASSDIPKNIETRLKDGNIVLVVKFENADTSYTFLVPH
ATTPRQLVVLALNKRANTLTLRDERPRDFTLKVCGQEEYFLTDHPLIQFSYVQDCIAKDN
VPTLVAVNINSIPVYKDHDYEDPDSDTLNRGTRPSFSTLTLRKKGKYTYSWNIEDQFKFN
VNGISRLNCDAAHRTVEVGLQAGLFHGGKSLCESQKTKDIVVRADGSCEWEETLSFDIKV
RDIPRNTRLCCVLYEIGKTSKGIKSRKLVKDSKQEYFINPLCWANTTIYDFKSQLKTGAM
TLYTWAYAEDIQNEDLLHPLGTVVSNPHIDRAAALMLTFPSYTRDQIILYPSPEKMVEFA
TKLSESRENSAEFDPTSVSDSDLQHHIDQLQLLADRDPLHELHEQERKTIWSLRQQCIMK
VPTILTKLLQCVEWNDHKEVSEATSLVLRWPKLPVERALELLDYAYADQTVRSFAVKCLK
DVSDEDLSLFLLQLVQALKHENYLSCELTEFLLRRALNNQRIGHFLFWHLRSEMHVGSVS
VRFGLILEAYCRGSQEHMKALFKQMECLDKLGSACDQVKQRKDRKTAQQCLQDYIKEAHC
REAFYNVMSPLNPSFRWSNIKVDKCRVMDSKMRPLCLAFQNLDQYGDDIYLILKHGDDLR
QDMLTLQMLRIMDKLWKNEGLDLRMNPYGCISTDNRVGLIEVVLNADTIANIQKEKGTFP
ATAAFRRGSLLAWLKDHNHSESTLNKAIEEFTLSCAGYCVATYVLGIADRHSDNIMVKKT
GQLFHVDFGHILGHFKEKFGIRRERVPFVLTNDFVHVINKGQTKKGQALEFQRFQNYCEQ
AFLVLRRHGSLILSLFAMMISTGLPELSSEKDLNYLRDTLVLEMSEAEAQKHFRSKFDEA
LCNSWKTSLNWASHNMAKSNKPM
NT seq 3312 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagacattttattaggagaacgcgatcaaaaattatcaaccaaaatgttagaa
ttacactacctagaagaagcaagaagcaaaatggttcatatccccaatagttacatgtat
aacttttggataaaaacgccaaccgaggtcgttgaactaacatgtttgatgcccaatggc
gtggttatcccactcgaggcgaatcgcaatacaactttagcagaaatcaaagaagatctc
tgggacgaagctagtaaatacccgttacatggaatattaagggattcacagtcttatata
tttttatgtatcaattccaatgccgaatccgaagagttgcgagatgaaagcagacgtttg
tgcgatatcaaacccttttgttctgtacttaaactcgtggaaaaggaggataccaaggtc
gacaggaatttggattcgcaaatcggtctcttgataggcaaaggtttgcacgagttcgta
gctctgaaaaattcggaagtcaacgactttcgatggaagatgcgattactcggagacgaa
atcgctctagatagacaaaagaaatcttggactgaaaaagtgctctatcaatttccgact
agattagccgcttcgtccgatataccgaagaacatcgagactcgactgaaagacggaaac
atagttctcgttgtaaagttcgaaaacgctgacacatcgtatacctttttagtgccgcac
gcgacaactccacggcagctcgttgtgctggctttgaataagcgcgcgaacactctgact
ctgcgtgacgaacgtccaagagatttcacgttaaaagtctgcggccaagaggaatatttc
ttgaccgatcatccacttattcaatttagctacgttcaagattgcatcgccaaggacaat
gttccaacactcgtcgccgtcaatataaacagtatccccgtatacaaggatcatgactat
gaagatccggactccgatacactgaatcgcggtaccagaccatcgttctcgacgcttacg
ctgcgaaagaaaggaaagtacacgtattcgtggaatatcgaagatcagttcaagttcaac
gtcaatgggatttcgcggctcaattgcgacgccgcgcacagaacggtggaagttggcttg
caggctggcctgttccacggtggcaagtccctctgcgagagccaaaagacgaaggacata
gtggtccgtgccgatggcagttgcgagtgggaggagacgctgagtttcgacataaaggta
cgtgatataccgagaaatacacggctatgctgcgttctttacgaaataggcaagacgtcg
aaaggcatcaagagccgaaagctcgtgaaagattccaagcaagaatatttcataaatcca
ctgtgttgggcaaacacaactatttacgacttcaaaagtcaactaaagactggcgctatg
actctttacacgtgggcttacgctgaagacattcaaaacgaagacttgctccatcccttg
ggcaccgtcgtatccaatccccacatagatcgagcagctgccctcatgttgactttccct
agttatacaagagatcaaataattctttacccgtctccggagaaaatggtcgagttcgcc
acgaagctcagcgaatcccgagaaaattcagcggaattcgatcctaccagcgtttctgac
tcggatctgcaacatcacatagatcaactccagctgctggcagaccgagatccactgcac
gagcttcacgagcaggaaagaaaaaccatctggtcgttgaggcagcagtgcatcatgaaa
gtcccgacgatactaacgaagctgttgcagtgcgtcgagtggaacgatcataaggaagtc
tcagaagcgacttccttggtactccgctggccaaagctgcccgtcgaaagagcattggaa
ctattggattacgcttatgccgaccaaacagttcgcagtttcgccgtgaaatgcttaaaa
gacgtgagcgacgaagacctgagtctgttcctactgcaactcgtgcaggctctcaagcat
gaaaattatttgtcttgcgagctcacagagtttttgttgaggcgcgctttgaacaatcag
cggataggccactttttgttttggcatctgagatctgagatgcacgtcggctctgtatcc
gtaaggttcggtctgattttggaagcttactgccgcggcagccaggagcacatgaaagct
cttttcaaacaaatggaatgcttggacaagctcggaagcgcgtgcgatcaagtgaaacag
cgaaaagatcgtaaaaccgcgcagcagtgtctgcaagattatattaaggaggcgcattgt
cgcgaggctttttacaacgttatgagtccgttgaatccaagttttagatggagcaacata
aaggtcgacaagtgcagggtgatggacagtaaaatgaggccactttgtttggcttttcaa
aaccttgatcagtatggagacgacatatacctgattttgaagcacggcgacgatcttcgg
caagatatgctgactttgcaaatgcttcggatcatggataaactgtggaaaaacgaaggc
ttagatttgcgaatgaatccctacgggtgtatatccactgataacagagtgggtctgatc
gaagtcgttttgaatgcagataccattgccaatattcaaaaagagaagggcactttccca
gccacggcggcgttcagaagaggatcgctgctggcgtggttgaaggaccacaatcactcg
gaatcaactttaaataaagcaatcgaagaatttacattgagctgtgccggttactgtgtc
gctacctacgtacttggcatcgcggaccgacactcggacaatataatggttaaaaaaacg
ggtcaactatttcacgtggatttcggtcacatattgggtcacttcaaggaaaagttcgga
attcgaagagaaagagtgcccttcgtattgacgaacgatttcgtgcacgtaattaataaa
ggacaaactaagaaaggccaggctctagaattccagagattccaaaattattgcgagcaa
gcgtttctagtattaagacgacacggtagtcttattttgtccttattcgccatgatgatt
tctaccggcttgccagaattatcgtcagaaaaggatcttaattatctccgagatacactg
gtcctggaaatgtctgaagctgaggctcaaaaacatttccgtagcaagtttgatgaagct
ctttgcaactcttggaagacctccttgaattgggcatctcacaacatggctaagagtaat
aaaccaatgtaa

DBGET integrated database retrieval system