KEGG   Nasonia vitripennis (jewel wasp): 100115855Help
Entry
100115855         CDS       T01081                                 

Gene name
AChE-1, CCE-J1, Nv1600458
Definition
acetylcholinesterase 1
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100115855 (AChE-1)
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     100115855 (AChE-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
4
AA seq 721 aa AA seqDB search
MPGQQQQQHRQHRVQERQREHEHHYHYHQHGRPAERAAGRRHARLNSAMALSLLLLALGL
DLRGALGSPSHRGRHHAASDLGLQQEQPRSMEAPLEEPLPRPEHLAAPQAQTLPPPPQPQ
QQQQQQQPGSDDPLVVQTKKGRVKGATLTATTGKKVDAWFGIPYAQKPLGPLRFRHPRPA
EAWEGVLNATSPPNSCVQILDTVFGDFSGAMMWNPNTPLSEDCLYVNVVAPKPRPTNAAV
MVWIFGGGFYSGTATLDVYDHRTIVSEENIILVSMQYRVASLGFLYFGTSDVPGNAGLFD
QMMALQWVRDNIAAFGGNPDNVTLFGESAGAVSVSMLLLSPLSRHLFNQAIMQSGSATAP
WAIITREESIMRGLRLAEAVGCPHDKSDLRAVIDCLISQEAEVLVNSEWGTLGICEFPFV
PVIDGAFLDETPQRSMLTESFKKANILMGSNTEEGFYFIIYYLTELFRIDGTEDVKVPRD
EFVRAVSELNPYVNPIGRYAIIYEYTDWLRPDDPDANRNALDKIVGDYHFTCNVNEFASR
YAETGNKVYMYYYTHRSANNPWPRWTGVMHADEISYIFGEPLDPTKGYTQEEKHLSKRMM
RYWANFAKTGDPNMGDDGSSWTEVTWPVHTATKKEYLTLDTNTTEIGYGPRVRQCAFWKK
YLPQLLAATSKLDQSKETCSGAAAPALDSRGACLLLMSLVTIGLRALSGASQLWPQPRGP
V
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgccggggcagcagcagcagcagcatcgccagcatcgagtccaggagcggcagcgcgag
cacgagcaccactaccactaccaccagcacggccggccggccgaaagagccgcgggacgg
cggcacgcgcggctgaactcggccatggcgctgtcgctgctcctgctggcgctcggcctt
gacctccggggcgcgctcggctcgccctcgcaccggggcaggcaccacgcggcctcggac
ctcgggctgcagcaggagcagccgcgatcgatggaggcgccgctggaggagccgctgccg
cgacccgagcacctggccgccccccaggcgcagacgctgcccccgccgccgcagccccag
cagcagcagcagcagcagcagcccgggagcgacgaccccctcgtcgtccagacgaagaag
ggccgcgtgaagggcgcgaccctgaccgccaccaccggcaagaaggtcgacgcctggttc
ggcataccctacgcccagaagcccctcggccccctgaggttccggcacccgcgaccggcc
gaggcgtgggagggcgtcctgaacgcgaccagcccgcccaacagctgcgtgcagatcctg
gacacggtgttcggcgacttctccggcgccatgatgtggaaccccaacacgcccctgagc
gaggactgcctctacgtgaacgtcgtcgcgcccaagcctcggcctactaacgccgctgtc
atggtatggatattcggtggcggcttctactcgggcacggcgaccctcgacgtctacgac
caccggacgatcgtcagcgaggagaacataatcctggtgtcgatgcagtaccgcgtggcc
agcctgggcttcctctacttcggcacctcggacgtgccgggcaacgccggcctcttcgac
cagatgatggcgctccagtgggtgcgcgacaacatcgccgccttcggcggcaaccccgac
aacgtcaccctcttcggcgagagcgccggcgccgtctcggtctcgatgctcctgctctcg
ccgctctccaggcacctcttcaaccaggcgataatgcagtccggctcggcgacggcgccc
tgggcgataataacgcgcgaggagtcgataatgcgcggcctgcggctggccgaggccgtc
ggctgcccccacgacaagtcggacctgcgcgccgtcatcgactgcctcatcagccaggag
gccgaggtgctggtcaacagcgagtggggcaccctcggcatctgcgagttccccttcgtg
cccgtcatcgacggggccttcctcgacgagacgccccagcgctcgatgctcaccgagtcc
ttcaagaaggccaacatcctcatgggctcgaacacggaggagggcttctacttcatcatc
tactacctgaccgagctcttcaggatcgacggcacggaggacgtgaaggtgccgcgcgac
gagttcgtgcgcgccgtcagcgagctgaacccctacgtcaacccgatcggccgctacgcc
atcatctacgagtacacggactggctgcggcccgacgaccccgacgccaaccgcaacgcc
ctcgacaagatcgtcggggactaccacttcacctgcaacgtcaacgagttcgccagcagg
tacgccgagacgggcaacaaggtctacatgtactactacacgcacaggtccgccaacaac
ccctggccgaggtggacgggcgtcatgcacgccgacgagatcagctacattttcggcgag
ccacttgaccccaccaagggctacacgcaagaggagaagcacttgtccaagaggatgatg
agatactgggcgaactttgctaaaactggggacccgaacatgggcgacgacggctcgtcg
tggacggaggtcacctggccggtgcacacggccacgaagaaggagtacctcacgctcgac
accaacaccacggagatcggctacgggccccgggtgaggcagtgcgccttctggaagaag
tacctgccccagctgctcgccgccacttccaagctggaccagtcgaaggagacctgcagc
ggcgcggccgcaccggcgctggactcgcggggcgcttgcctgctgctcatgtccctggtg
acgatcggactgcgcgccctgtcgggcgcctcgcagctctggccgcagcctcgcggaccc
gtctag

DBGET integrated database retrieval system