KEGG   Nasonia vitripennis (jewel wasp): 100116051Help
Entry
100116051         CDS       T01081                                 

Gene name
Rpd3
Definition
Rpd3 histone deacetylase
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:nvi04330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
1
AA seq 492 aa AA seqDB search
MSQLQHSRKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAT
ADEMTKFHSDEYIRFLRSIRPDNMTEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAA
AVKLNKQASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNIPLRDGMDDDSYESI
FVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNLPFLMVGG
GGYTIRNVSRCWTYETSVALGSEIANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLE
KIKTRLFENLRMLPHAPGVQVQAIPEDGAVIEDSEADEKVNPDERLPQRDIDKRLQHENE
FSDSEDEGEGGRRDNRSFKGSRKRPRLEKGQENAEGDVKKEDEIKSEVKENEKDEKSNST
NEETKKDGGANP
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagttacagcatagccgcaagcgagtctgttattactacgacagcgatattggc
aactattactatggacaaggtcatccaatgaaaccacaccgcataaggatgacacataat
ttattattaaactatggactctatcgtaaaatggaaatttatcgaccacataaagctact
gccgatgaaatgactaagtttcatagtgatgaatatattagatttttaaggtcaatcagg
cctgataatatgactgaatacaacaaacaaatgcaaagatttaatgttggtgaggattgt
cccgtttttgatggtctctatgagttttgtcaattatctgctggtggatcagtagctgca
gctgtaaaattgaataagcaagcttctgaaatttgcattaactggggtggaggacttcat
cacgcgaaaaaaagtgaagcctcaggtttctgctatgttaatgatatagtgcttggcatt
ttagagttacttaaataccatcaaagagttttgtatattgatattgatgtccatcatggt
gatggagtcgaagaagccttctatacaacagatagagtaatgacagtttcattccataaa
tatggagaatatttccctggaactggtgatctcagagacattggcgctggaaagggaaaa
tattatgctgtcaatattcctcttagagatggcatggacgatgatagttatgagtctata
tttgtaccaataatttctaaagtgatggaaactttccagccatcagctgttgtacttcaa
tgtggagctgattctttgactggagacagattaggttgttttaatctcactgtaagaggg
catggaaagtgtgttgagtttgtgaagaaatacaacttgcctttcttaatggttggtggt
ggtggctacacaattaggaatgtttcaagatgctggacatatgaaacctcggtagcgctt
ggttcagagatagcaaatgaactaccatacaatgactattttgaatactttggaccagat
ttcaaattacacattagtccatcaaatatggcaaatcagaatactcctgaatatttagaa
aaaatcaaaactagattatttgaaaatcttaggatgttgcctcatgcgccaggagttcaa
gtacaagctattccagaagacggtgccgtcattgaagactctgaagctgatgagaaagta
aatcccgatgaaagacttcctcagcgcgacattgacaaaaggttacaacatgaaaatgaa
ttcagtgatagtgaagatgaaggtgaaggtggcagaagggataacagatcttttaagggt
tcaaggaaacgaccacgattagaaaagggtcaagaaaatgcagagggtgacgttaaaaaa
gaagacgaaatcaaatccgaagtgaaagaaaatgaaaaagatgagaaatcaaattctact
aatgaagaaactaaaaaagatggaggagcaaatccctga

DBGET integrated database retrieval system