KEGG   Nasonia vitripennis (jewel wasp): 100116354Help
Entry
100116354         CDS       T01081                                 

Definition
neuroendocrine convertase 2-like
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     100116354
Peptidases [BR:nvi01002]
 Serine Peptidases
  Family S8: subtilisin family
   100116354
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
2
AA seq 682 aa AA seqDB search
MASARVTVASLAVPRSCRGSRGRLDEPSPGSRARAPRQHRGTMRLRPLLLLAGLLALLGE
ARAELFTNSFLVKMRQPAARQVADRIASRNGFVNLGPVLGSQTEYHFVHRTLPHARSKRS
VAQTRRLKVDPLVHTAVQQPGFKRVKRGYKPLSVEKLVPLMKSEMKNPASKPASRDPTDP
YFQYQWYLKNTGQNAGKPKLDLNVEAAWAQGFTGKNVTTAIMDDGVDYMHPDLKYNYNAK
ASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVAAARDNGVCGVGVAYDSKVAGIRMLDQP
YMTDLIEANSMGHEPDLIDIYSASWGPTDDGKTVDGPRNATMRAIVRGVNEGRKGLGNIY
VWASGDGGEDDDCNCDGYAASMWTVSINSAINDGQNAHYDESCSSTLASTFSNGAKDPNT
GVATTDLYGQCTTTHSGTSAAAPEAAGVFALALEANPQLTWRDIQHLTVLTSKRNSLFDA
KGRFHWTMNGVGLEFNHLFGYGVLDAGAMVALASKWKTVPPRYHCMAGTVQQVQEVPSHR
SILLKIETDACAGTDLAVNYLEHVQAVISVNATRRGDLELFLTSPMGTRSMILSRRANDD
DRRDGFTKWPFMTTHTWGEYPQGTWLLEVSFNSQAPQHGWIREFTLMLHGTREPPYTGLP
AADPHSKLAIVKKAHEERSTAM
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtgcacgcgtgaccgtcgcttctttggcggtgccgcgctcgtgccggggcagc
cgcggccgcctcgacgagccgtcgccggggagtcgagctcgggctccgcggcagcaccgc
gggacgatgagactgaggccgctgctcctgctggccgggctgctggcgctgctcggggag
gcgcgcgccgagctcttcaccaacagcttcctcgtcaagatgaggcagcccgcggccagg
caggtcgccgacaggatcgccagcaggaacggcttcgtcaacctcggcccggttctgggc
agtcagacggagtaccactttgtgcacaggactctgccgcacgcgaggagcaagcgctcc
gtcgcccagacgcgaagactgaaggtggatcccctggtgcacacggcggtgcagcagccg
ggcttcaagcgagtgaagcgcggctacaagccgctcagcgtggagaagctcgtgccgctg
atgaagagcgagatgaagaacccggcatcgaagcccgcctcgcgcgatcccacggatccg
tacttccagtatcagtggtacctcaagaacaccggccagaacgccggcaagcccaagctc
gatctgaacgtcgaggctgcctgggcgcagggcttcaccggcaagaacgtcaccaccgcc
atcatggacgacggagttgactacatgcatcccgacctcaagtacaattacaacgcgaaa
gcttcgtacgacttcagcagtaacgacccgtacccgtacccgaggtacacggacgactgg
ttcaacagccacggaacgaggtgcgccggcgaggtggcggcggcccgcgacaacggcgtc
tgcggcgtcggcgtcgcctacgactcgaaggtcgcgggcatccgcatgctggaccagccc
tacatgaccgacctcatcgaggccaacagcatgggccacgagccggacctcatcgacatc
tacagtgcctcctggggcccgaccgacgacggcaagaccgtcgacggcccgaggaacgcg
acgatgcgagccatcgtccggggagtgaacgagggccgcaagggcctcggcaacatctac
gtctgggcctcgggcgacgggggcgaggacgacgactgcaactgcgacggctacgccgcg
agcatgtggaccgtcagcatcaacagcgcgatcaacgacggccagaacgcccactacgac
gagagctgctcgagcactctggcctcgactttcagtaacggcgccaaggatcccaacacc
ggagtggcgacgacggacctctacgggcagtgcacgacgacgcacagcggaacatcggcc
gccgcgccggaagctgccggcgtgtttgctctggctctggaggccaacccgcagctgacc
tggcgggacatccagcacctgacggtgctcacctccaagaggaactcgctcttcgacgcc
aagggcaggtttcactggaccatgaacggcgtcggcctcgagtttaaccacctcttcggc
tacggagtcctggacgccggggccatggtcgccttggccagcaagtggaagaccgtgccg
ccgagatatcactgcatggccggcaccgttcagcaagtgcaggaagtgccgagccatcgg
tccatcctcctgaagattgagacggacgcctgcgccgggacggacttggccgtgaattat
ctggagcacgtgcaggccgttatttcggtgaacgccacgcgcagaggagatctggaactt
ttcctaacgtcgccgatgggcacgaggtcgatgattctcagcagaagggcgaacgacgac
gatcgtcgggacggtttcaccaagtggccattcatgaccacccacacctggggagagtat
ccgcaaggaacctggcttctggaggtgagcttcaactctcaggcgccgcagcacggctgg
atccgtgagttcacgctgatgctccacgggacgcgggagccgccctacaccgggctccca
gccgcggatccgcactcgaagctggcgatcgtgaagaaggcgcacgaggagcgcagcacg
gccatgtaa

DBGET integrated database retrieval system