KEGG   Nasonia vitripennis (jewel wasp): 100116596Help
Entry
100116596         CDS       T01081                                 

Definition
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1-like
Orthology
K05860  
phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100116596
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    100116596
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100116596
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
4
AA seq 1923 aa AA seqDB search
MELEKRPQPQLPRSSEELEDLQKLLHFPEEVALRLAESEYQLFYQVPPGEYLRHVSQDFT
ASQQRQQQQQQRDQAKGEASSDTSQTAGPSLTSSSTQTEDEACWPTSTASVSVQTLIDRF
NEVNSWVSHVISSGSTVEERQALLSCLLRVAQTCWNIGNFNSAMEIVAGLKSNKLKPFWQ
TVSEQIPVLDYLSSALLSSEYEHALARALSMPECPVVPFFGAFLRELREVIANASKHPPE
SREKETLRASSKEGESLENVPLPSPAQPHHLHLHHHHHHHHHHHHHHQSQHSSHEADQQQ
QRRRTFERAESRSEQPLSPRRRISENDGTTAGVLDKVMLFHQHRHARGRDATTGSLHRTL
SVHTTTLEQTYMSEECDENDYHLDLDSYRPVQPLKHDHGVSLFPVAAPQNGMDLHLLQLL
HHGTTLVHWECEGGASRTALVFARVDRACGTFIWEKPSWSPLKTGVGSSSLGPISADYNL
AVNAEDGVTSGLVQRYSAQPPDCSTVTLEEGHLDLSCVKEVMIGCCDRDRDQDLRSICKR
YGLPGSDSCIGLMYGANLSDNRLIFLLCPPALSKIWYMGLCWILRGLKRQQQLTDRRSRW
LKEKYLQLYFDEGCVEPMTADAIRVFGGRDWSMTESVGTLSPTSSSTMRKRNVKSKKTKS
IGNIHALTKDLSFKQYETSSSDGGLSATPLRHMQGSRESLTKIIPASPRSSRDRIPPRSP
PGSAERVVSLPYASLQSLLCVARDKEKNGSSGGGGGIAGASGGSGSVPGLGLSTGFEAPW
QVKARATSIMYETQLNFVEFVALFRSFSLRARKDLRDLFGQLAITCRSQSDGSLRDFNIR
PSVLRQTSDATPQRIGLLTRNNSIDCHEYKSSSNLHKKQIFDAIAAASIVNNCSGVDTSK
SQVITLATFTKFLESRQQEKLSDDEIKALIKRHEPDPALRTQWCLSFEGFARYMMDKDNY
AFPNEYALPAECEMQQPMSQYYIASSHNTYLTGHQLKGESSVQLYSQVLLTGCRCVELDC
WDGDDGSPLIYHGHTFTTKIPFRSVVEAIDRSAFVSSPYPVILSIENHCSQSQQARMAQI
FQSVFGEKLVTKFLFDSDFDDPQLPSPSQLRYRILIKNKKLVVDPTGPLVPLPAAHRGKM
LMSERASSMKQMRTDISSPPVVDYYSEDEDDDEDDDEDDNVDDNSISSYERYLGSGGQAP
HGRLKSDPAVDDKTQKQSSQIAKELSDLVIYLQAIKFRGLNMAPGPASVSKTSRHQPHTG
QVQRHSIAGIGTSGVAGSSSGSPQSLSTSTSIASGGSNIENPFRSQRGMPACFQTSSLNE
SAAKKICRKQPLGVLGHAETQLIRTYPAGMRIDSSNFNPVIFWAFGIQMVALNYQTDDAA
LHLNAAMFEQNGQCGYVRKPSVMWDKKHMMYRRFNPWDKEFDGLHSAHLTLSIISGQYVS
PSNLLSSTYVEIELVGIPIDCAKHKTKVIQGNSLNPIWNDKFCFQVMFKDLAFLRFGIMD
ASSHHPIAQRVLPLKCLRPGYRHVRLRTMKNRALALSTLFIYSRMEEESLDYNTCCRDHK
DASKRLSSSKEPEKLTAVEPAGLGGVTLKRRMFFLMVYHVMPEEPYTILKVTQESTTHEV
MLQALQKANISSDHVDEYILVEEVSRGWEKRDREELPTQRVLDQTEQPLQAQALWKGQGR
FLMKRVGDDPSSRAWLASIRSTAGHSKLGENGGPAAAASRDREQATHIWEEADTFLVCVY
NVSPDIPYAILRVPVTSSAQDVLAQALVKARRMEDPTKFALVEELEWGGTGAVGSGKCQF
RILGDNENVYSTQAFWKTLGRFILREREQAVPRRHLLPATLDRLSKGFSVGRSVSLPGSS
KEKVPVAEALSDPTSRTARHRFLLPGKRREVHSDGEDARESDLMNAAMQLKKMSLRKFCA
WKS
NT seq 5772 nt NT seq  +upstreamnt  +downstreamnt
atggagctggagaagcggccgcagccgcagctgcctcggagctctgaggagctggaggat
ttgcaaaaactgctgcacttcccggaggaggtggcgctcagattggccgagagcgagtac
cagctgttttaccaggtgccgcccggcgagtacctccgtcacgtctcacaggacttcacg
gcctcgcagcagcgccagcagcagcaacagcagagagatcaggccaagggcgaagcttct
agcgataccagccagacggccggtccaagcctcaccagcagctcgacccaaaccgaggac
gaggcctgctggcctacctccacggcctccgtcagcgtgcagacactcatcgatcgcttc
aacgaggtgaactcatgggtgagccacgtgataagcagcggatctacggtcgaggaaagg
caagccttgctctcgtgtctgctgagagtggctcagacctgctggaatatcggcaacttt
aattccgccatggaaattgtcgctggtctcaaatcgaataagctgaagcctttctggcag
actgtaagcgaacagatcccagtcttggattacctctcttccgctcttctgtcttccgag
tatgaacatgccctggcccgcgccctgtcgatgcccgagtgccccgtggtgcccttcttc
ggagcgttcttgcgcgagctccgggaggtcatcgctaacgcctcgaagcatcctccggag
agcagagagaaagagactttgcgcgctagcagtaaggagggcgagtccctcgaaaacgtg
cctttaccctcgcccgcccagcctcaccatctccacctccaccatcaccaccatcatcac
catcaccatcaccatcaccatcagtcccagcactccagccacgaggccgatcagcagcag
caacgtcggcgcacgttcgagcgagccgagagtcgctcggagcagccgctgtcgccgcgc
cgcagaatctccgagaacgatggcacgaccgcgggcgtcctcgataaggtcatgctcttc
caccaacaccgacacgctcggggaagagacgcgaccacgggctcgctccatcgcacactg
agcgtgcacacgacgaccctggagcaaacgtacatgtccgaggagtgcgacgagaacgac
taccatctggatctcgactcctaccggccggtacagcccctcaaacacgaccatggggtc
tccctcttccccgtcgcagcgccgcagaacggcatggatctgcacttgttacagctgctg
catcacggtacgacgctggtacactgggagtgcgagggtggggcgtcgcgcaccgccctg
gtgttcgcgcgggtcgaccgggcctgcggcaccttcatctgggaaaaaccgagctggagt
ccgctgaaaacgggcgtgggcagcagcagccttggtccgatctcggccgactacaacctg
gctgtgaacgcggaggacggggtgaccagtggcctggtgcagcgttactcggcccagccg
ccggactgctccacggtcaccctggaggagggccacctcgacctctcctgcgtgaaggag
gtcatgatcggctgctgcgaccgtgaccgagatcaggacctccggtcgatctgcaagagg
tacggcctgcccggctcggattcctgcatcggcctcatgtacggcgccaacctctccgac
aaccggctcatcttcctgctctgtccgccggccctcagcaagatctggtacatgggtctc
tgctggatcctgcgtggcctgaagcgccagcagcagctgacggatcggcgctcgcgctgg
ctcaaggagaagtacctgcagctctacttcgacgagggctgcgtcgagcctatgaccgcg
gacgcgatacgcgtcttcggcggccgcgactggtccatgacggagagcgtgggcacactg
tcaccgacgagcagcagcacgatgcgcaagcgaaacgtcaagagcaagaagaccaagtcc
atcgggaatattcacgcgctgacaaaggacctgagcttcaagcagtacgagacctcgtcg
tcggacggcggcttgtcggcgacgcctcttcgtcacatgcagggcagcagggagtctttg
acgaaaatcattccggcctctccgcgctcgagcagagatcgcatacctccccgcagtccg
cccggctcggccgagcgagtcgtcagtctgccttacgccagccttcaaagcctattgtgt
gttgccagagacaaagagaagaacggctcgagtggcggcggtggcggcatcgccggagcc
agcgggggcagcggcagcgtccccggccttgggctgtccacgggcttcgaggccccgtgg
caggtgaaggcgcgcgccacctccattatgtacgagacccagctgaacttcgtcgaattc
gtcgcgctcttcaggtcgttcagcctgagggcgcgcaaggacctgagggacctctttggc
cagctggccatcacctgccgcagccagagcgacggctcgctgcgcgactttaacatacga
ccgtcggtcctgagacagacgagcgacgcaacaccacaacgaatcggtctattaacacgc
aacaattccatcgactgtcacgagtacaaaagcagcagtaacctacacaagaagcaaatt
ttcgacgccatagcagccgcaagcattgtgaacaattgctccggcgtggatacctccaag
tcccaggtcataacgctcgccaccttcaccaagtttctcgaatcgcgccagcaggaaaaa
ctcagcgacgatgagatcaaggctctcattaagaggcacgagcctgatccagcgctgcgc
acacagtggtgtttgtctttcgagggcttcgcccgttacatgatggacaaggacaattac
gcctttccgaacgagtacgccctgccggccgagtgcgagatgcagcagcccatgtcccag
tactacatagccagctcgcacaacacttacttgaccgggcaccagctcaagggcgagtcc
tcggtgcagctctactcccaggttctgctgaccggctgtcgatgcgtggaattggactgc
tgggacggtgatgacggctcgcctctaatctaccacgggcacactttcaccacgaaaatc
cctttccgctccgtcgtcgaggcgattgacaggagcgccttcgtaagctcgccatacccc
gtcatactatcgatagagaatcactgctcgcagagtcaacaggcacgaatggcccagatc
tttcaatccgtgttcggagagaagctggtgacgaaattcctcttcgactcggacttcgac
gacccgcagctgccgtcgccgtcgcagcttcgctaccgcatactcatcaagaacaaaaaa
ctggtggtcgaccccacggggccgctggtgccgctgccagcggcgcaccgcggcaaaatg
ctcatgtccgagcgggcctcctcgatgaagcagatgcggacggacatcagcagccccccc
gtcgtcgactattacagcgaagatgaggacgacgacgaggacgacgacgaggacgacaac
gtcgacgacaactcgatatccagctacgagcgctacctgggcagcggcggccaggctccc
cacggccggctgaagagcgacccggcggtcgacgacaagacgcagaagcagagcagccag
atcgcgaaggagctgtccgacctcgtgatctatctgcaggccatcaaattccgcggcttg
aacatggcgcccggaccggctagcgtgagcaagacgagccgccaccagccgcacaccggc
caggtgcagaggcacagcatagcgggcatcgggaccagtggcgtggccggctcctcctcc
ggctcgccgcagagcctctccacctccacgtcgatcgccagcggcggcagcaatatcgag
aatcccttcagatcgcagcggggcatgccggcctgcttccagacctcctcgctgaacgag
agcgcagccaagaaaatctgccgcaagcagcctctgggcgtgctggggcacgcggagaca
cagctgatcaggacctacccggccggcatgcgcatcgactcgtccaacttcaacccggtg
atattctgggcgttcggcatccagatggtcgcgctgaattaccagacggacgacgcggcc
ctgcacctcaacgcggcgatgttcgagcagaacggccagtgcggctacgtgcgcaagccc
tccgtcatgtgggacaagaagcacatgatgtacaggcgcttcaacccctgggacaaggaa
ttcgacgggctccactcggcccacctgaccctgtcgatcatctccgggcagtacgtctca
ccgtcgaatctgctgagcagcacgtacgtcgagatcgagctggtcggcatcccgatcgac
tgcgccaagcacaagaccaaggtcatccagggcaactcgctgaaccccatctggaacgac
aagttttgcttccaggtgatgttcaaggacctggcctttcttcgcttcggcatcatggac
gcgagctcgcaccacccgatagctcagcgcgtcctgcccctgaaatgcctgcgcccaggc
taccggcacgtgcggctgcgcaccatgaagaaccgggccctcgccctctcgaccctcttc
atctactcgcgcatggaggaggagagcctcgactacaacacctgctgccgcgaccacaag
gacgcctcgaagcggctctcctcgagcaaggagccagagaagctgacggccgtcgagccg
gcgggcctcggcggcgtcaccctcaagcggcgcatgttcttcctcatggtctaccacgtc
atgcccgaggagccctacacgatcctcaaggtcacgcaggagagcacgacgcacgaggtg
atgctgcaggcgctccagaaggccaacatctcttcggaccacgtggacgagtacatcctc
gtggaggaggtgtcgcgcggctgggaaaagcgggaccgcgaggagctgccgacccagcgc
gtcctcgaccagacggagcagccgttgcaggcgcaggccctctggaagggccagggccgc
ttcctgatgaagcgcgtcggcgacgacccgagcagccgggcctggctcgcctctatccgc
agcacggccggccactcgaagctcggcgagaacggcgggcccgcggcggcggcgagccgc
gaccgcgagcaggcgacgcacatctgggaggaggccgacaccttcctcgtctgcgtctac
aacgtctcgccggacatcccgtacgcgatcctgcgcgtgcccgtgaccagctcggcccag
gacgtactcgcccaggcgctggtcaaggcgcgccgcatggaggatccgaccaagttcgcc
ctggttgaggagctcgagtggggcggcaccggcgccgtcggcagcggcaagtgccagttc
cgcatcctcggtgacaacgagaatgtctacagcacgcaggccttctggaagacgctgggc
cgcttcatcctgcgggagcgcgagcaggccgtgccccggcggcacctgctcccggcaacc
ctcgaccggctgagcaagggcttctcagtcggccgctcggtctcgttgcccggctcgagc
aaggagaaggtcccggtggccgaggcgctctctgacccgacctcgcgcaccgccaggcac
cgcttcctactgcccggcaagagacgcgaggtgcactcggacggcgaagacgcccgcgag
tccgacctcatgaacgcggcgatgcagctcaagaagatgtcgctccgcaagttctgcgcc
tggaagtcatag

DBGET integrated database retrieval system