KEGG   Nasonia vitripennis (jewel wasp): 100116736Help
Entry
100116736         CDS       T01081                                 

Gene name
SUV39H1
Definition
histone-lysine N-methyltransferase SUV39H2
Orthology
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100116736 (SUV39H1)
Enzymes [BR:nvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100116736 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
2
AA seq 503 aa AA seqDB search
MILSDDLFDDDNIKDSKRSANTLAENDIFLSHTIFKRPQKENTYANSINIFKKVELKELR
VQLEDIRHAKIMTKSDGHPNLYEVEEIVGKKIENYIIYYLIKWKNWSADYNTWEPVKNLT
NCAELLKEFEDGRLKLLERFQKYSNFYPDTSVIERHMLDLFRQGKKIDSSLINTDHLYEK
IKMFFSINNKKTKTLAENIKENILHMLVYNSRTEQLASLKDWENEMNSITKGNPSIKVEN
LVDLERAPQEFLYIDDYLPGSGVIIPEEPPIGCECSICDSKTKCCYAMCDGSLPYTSARR
IRVPPGTPIYECNKRCICPDNCQNRVVQRGSQMKLCVFRTSNGRGWGVKTLRVIKKGTFV
IQYVGEVITNEEAEKRGKEYDAAGRTYLFDLDYNETEGQCPYTVDAAIYGNISHFINHSC
DPNLAVYAVWIDCLDPNLPKLALFATKDIKQNEEITFDYMRQTVKDDLLRQRLELPEEMC
NNKSLEHRTRCKCGASICRQYLF
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgattttatcagatgatttatttgatgacgataacataaaggattcaaaaaggtcagct
aatactttagcagaaaatgatatttttttatcacatacaattttcaaaagacctcaaaaa
gaaaatacctatgcgaacagtataaatatatttaaaaaagtagaattaaaagagttacgt
gtgcaacttgaagatattagacatgcaaaaattatgacaaaatctgatggacatcctaat
ttatatgaagttgaagaaattgtcgggaagaaaatagagaattatatcatttattattta
attaaatggaaaaattggagtgcagactataatacttgggaacccgttaaaaatttaaca
aattgtgcagaattattaaaggaatttgaagatggaagattaaaattattagaacgattt
caaaaatattcaaacttttatcctgatacaagtgttatagaacgacatatgttagattta
ttccgtcaaggtaaaaaaatcgattcatccttgataaatacagatcatttgtatgaaaaa
atcaaaatgtttttcagtattaataacaaaaaaactaaaaccttagcagagaatataaaa
gaaaatattttacatatgttagtatacaattcgagaaccgaacagttagcttcattaaaa
gattgggaaaacgaaatgaatagcataacaaaaggtaacccatcaatcaaagttgaaaat
ttggtagatctagaacgagcgccacaagaatttctttatattgatgattatttacctggt
tctggtgtcattatacctgaagaacctccgattggttgcgaatgttctatatgtgattca
aaaactaaatgttgttatgctatgtgtgatggaagtttgccatatacatctgctcgtaga
attcgcgttcctcctggtactccaatatatgaatgtaataagcgctgtatttgtccagat
aactgccaaaatcgtgttgttcagcgtggctcacaaatgaaactttgtgtatttaggact
tcaaatggtcggggttggggagtaaaaactttacgtgtaatcaaaaaaggaacatttgtt
attcaatatgtcggggaagttatcacaaatgaagaagcagaaaagcgtggtaaggaatat
gatgccgcaggaagaacctatctttttgatcttgattataatgaaacagaaggacaatgt
ccatatactgtagacgcagctatttacgggaatatatctcattttattaaccattcatgc
gatccaaatttagctgtttatgctgtttggattgattgtctcgatccaaatttacctaaa
cttgctctttttgcaacaaaagatataaagcaaaatgaagaaataacatttgactatatg
cgccaaacagttaaagatgatttattacgacaaagacttgaattgccagaagaaatgtgc
aacaataaatctttggaacatcgaactcgatgtaaatgtggagctagtatttgtcgacaa
tatcttttttaa

DBGET integrated database retrieval system