KEGG   Nasonia vitripennis (jewel wasp): 100116736Help
Entry
100116736         CDS       T01081                                 

Gene name
SUV39H1
Definition
(RefSeq) histone-lysine N-methyltransferase SUV39H2
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100116736 (SUV39H1)
Enzymes [BR:nvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100116736 (SUV39H1)
Chromosome [BR:nvi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100116736 (SUV39H1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100116736 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
NASONIABASE: 
Position
2
AA seq 643 aa AA seqDB search
MGGEETIDFTDKMSNLLKQDLLQLDSDSRNMPSEKVSTHRSSIEGKVGADSYTIETFKNL
SEVRTVRLKNESQRDITVKLEECAAECSRGEEADLPGNPTILSFISDKRPISPGSCHPSA
KQPKIEEVEHLVSTKNIHANMILSDDLFDDDNIKDSKRSANTLAENDIFLSHTIFKRPQK
ENTYANSINIFKKVELKELRVQLEDIRHAKIMTKSDGHPNLYEVEEIVGKKIENYIIYYL
IKWKNWSADYNTWEPVKNLTNCAELLKEFEDGRLKLLERFQKYSNFYPDTSVIERHMLDL
FRQGKKIDSSLINTDHLYEKIKMFFSINNKKTKTLAENIKENILHMLVYNSRTEQLASLK
DWENEMNSITKGNPSIKVENLVDLERAPQEFLYIDDYLPGSGVIIPEEPPIGCECSICDS
KTKCCYAMCDGSLPYTSARRIRVPPGTPIYECNKRCICPDNCQNRVVQRGSQMKLCVFRT
SNGRGWGVKTLRVIKKGTFVIQYVGEVITNEEAEKRGKEYDAAGRTYLFDLDYNETEGQC
PYTVDAAIYGNISHFINHSCDPNLAVYAVWIDCLDPNLPKLALFATKDIKQNEEITFDYM
RQTVKDDLLRQRLELPEEMCNNKSLEHRTRCKCGASICRQYLF
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgggaggtgaagaaactattgattttactgataagatgtcaaacttgttaaaacaggat
ttgttgcaactagattccgacagcagaaatatgccatccgagaaagtttctacacatcga
agtagcattgaaggaaaagttggagctgattcatacactatagaaacattcaaaaatcta
tcagaagtacgaacagtaagattaaaaaacgagagtcaaagagatattacagtaaaatta
gaagaatgtgcagcagaatgtagtcgtggagaagaagcagacctacctggaaatccaacg
atattatcttttatttctgataaacgacccatctctcctgggagctgtcatccttcagct
aagcaaccaaaaattgaggaagtagaacatctagtaagcacgaaaaacattcatgctaat
atgattttatcagatgatttatttgatgacgataacataaaggattcaaaaaggtcagct
aatactttagcagaaaatgatatttttttatcacatacaattttcaaaagacctcaaaaa
gaaaatacctatgcgaacagtataaatatatttaaaaaagtagaattaaaagagttacgt
gtgcaacttgaagatattagacatgcaaaaattatgacaaaatctgatggacatcctaat
ttatatgaagttgaagaaattgtcgggaagaaaatagagaattatatcatttattattta
attaaatggaaaaattggagtgcagactataatacttgggaacccgttaaaaatttaaca
aattgtgcagaattattaaaggaatttgaagatggaagattaaaattattagaacgattt
caaaaatattcaaacttttatcctgatacaagtgttatagaacgacatatgttagattta
ttccgtcaaggtaaaaaaatcgattcatccttgataaatacagatcatttgtatgaaaaa
atcaaaatgtttttcagtattaataacaaaaaaactaaaaccttagcagagaatataaaa
gaaaatattttacatatgttagtatacaattcgagaaccgaacagttagcttcattaaaa
gattgggaaaacgaaatgaatagcataacaaaaggtaacccatcaatcaaagttgaaaat
ttggtagatctagaacgagcgccacaagaatttctttatattgatgattatttacctggt
tctggtgtcattatacctgaagaacctccgattggttgcgaatgttctatatgtgattca
aaaactaaatgttgttatgctatgtgtgatggaagtttgccatatacatctgctcgtaga
attcgcgttcctcctggtactccaatatatgaatgtaataagcgctgtatttgtccagat
aactgccaaaatcgtgttgttcagcgtggctcacaaatgaaactttgtgtatttaggact
tcaaatggtcggggttggggagtaaaaactttacgtgtaatcaaaaaaggaacatttgtt
attcaatatgtcggggaagttatcacaaatgaagaagcagaaaagcgtggtaaggaatat
gatgccgcaggaagaacctatctttttgatcttgattataatgaaacagaaggacaatgt
ccatatactgtagacgcagctatttacgggaatatatctcattttattaaccattcatgc
gatccaaatttagctgtttatgctgtttggattgattgtctcgatccaaatttacctaaa
cttgctctttttgcaacaaaagatataaagcaaaatgaagaaataacatttgactatatg
cgccaaacagttaaagatgatttattacgacaaagacttgaattgccagaagaaatgtgc
aacaataaatctttggaacatcgaactcgatgtaaatgtggagctagtatttgtcgacaa
tatcttttttaa

DBGET integrated database retrieval system