KEGG   Nasonia vitripennis (jewel wasp): 100116753Help
Entry
100116753         CDS       T01081                                 

Gene name
CYB5R2
Definition
cytochrome b5 reductase 2
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100116753 (CYB5R2)
Enzymes [BR:nvi01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     100116753 (CYB5R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
3
AA seq 315 aa AA seqDB search
MADAGEAQQQIAGPKVLPVLAAVGTLLAVGIAVKLYLSFKDTKKKKKVLLEEPTVKYALP
LVEKQIISHDTRLYRFGLPTSEHVLGLPIGQHVHLTAKVNEEVIIRAYTPVSSDDDKGHV
DLVVKVYFKNVHPKFPEGGKMSQHLESLKVGETVDFRGPSGRLMYKGRGSFSIKILRKEP
PVEYNVSKVVMIAGGTGITPMLQLIRAIAKDPEDKTKVSLLYANQTEKDILLRDELEEVA
KNHPDQVKVWYTIDTSTEGWKYSTGFVNADMISEHMYPPSPDTIVLMCGPPPMINYACTP
NLDKLGYDSKLRFAY
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgcaggagaagcacagcagcagatcgccggtccgaaggtcctgcctgtcttg
gctgctgtgggaacactcctagcagtaggcatagcagtgaagctctacctgtccttcaaa
gacaccaagaagaagaagaaagtactcctcgaagagccaacagtcaagtatgccctgccc
ctcgtcgaaaaacaaatcataagccatgacactagactatacaggtttggcctgccaacc
tcagagcatgtactcggtttacctattggtcagcatgtgcatttaactgccaaggtaaac
gaagaagttatcattcgtgcatatactccagtttccagtgacgatgacaaagggcacgtt
gaccttgttgtcaaggtctacttcaaaaatgttcaccccaaattccctgagggaggcaaa
atgtcgcagcatcttgagagtcttaaagtaggtgagactgtagacttcagaggaccgtct
ggtagactgatgtacaaaggccgtggttcattttccattaagatacttagaaaggaacct
cccgtagagtataatgtttccaaggtagtaatgattgccggaggcacaggtatcacacca
atgttgcagctcattagagctatagccaaggatccagaagataagacaaaagtatctctg
ctttatgcgaaccagactgaaaaagacattctattgagggatgagttggaggaagttgcc
aagaaccatccagaccaagttaaggtttggtacactattgacacaagcactgaaggctgg
aagtacagtaccggttttgtcaatgctgacatgatctctgaacacatgtatccaccatca
ccggatacaatagttctcatgtgtgggccgccaccgatgataaattacgcttgcacaccg
aatctggataaactgggatatgattcaaaactgcgattcgcctactag

DBGET integrated database retrieval system