KEGG   Nasonia vitripennis (jewel wasp): 100116786Help
Entry
100116786         CDS       T01081                                 

Definition
histone acetyltransferase KAT6B-like
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100116786
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
2
AA seq 2818 aa AA seqDB search
MEEPDPETWTAWFLDAIRKIRSQKQRPSVERIAHAIRLQHDYHEEVIAENLQLAVKRGDV
LKLFNKGQSSYKDPGGLQSKPLKVSRTSDLCKVIIKAVRELGERDGSNLKNIEKYVRQSH
SVDEEQEGDLRTALRLSAKRAVDRGLVLQEGRLFRQPDRPIHLAKKFNAEREHNDSLTPK
LPAPLPICKECLGATAAGPNNNKRNSSGGATTPSSQGSINSQASTEKSLSRCSVCGAALH
TSCAPPELAVLIERGASWSCDDCSSTCAGCQEERESQSYLVKCAGCPKCYHPGCLEPALD
KRSKAPWRCRHCQTTHQQPDAAGKKLAEAKQPLASTPTSARKRLSNIRENRKSMASSRKS
TSLTAGSAAAAATTPTSTTAASTPSGKKSSPSQAQVDSSSDGNAGVVSPRQPNPLSSSHS
PNHHSLPHHHHHVQSTGQGGGGGGRLLEEKNDRISKEKQKFFRLSVFNAKHNKLKRAAAA
AANTSSSSSNTSHVSPDKASKALVAEDNPTRSSRNTGSNASSSKKSVASANRRVPPLPSQ
SEDEDEVEDDDDDDDDDDDDDEESGADEKVQEEEEEDDDDECSSTSSDDDNYTSCEEELP
ASDHRLRMVQPTSKPPPPLPPPPSSSSSSANRAPGKTSGNSKGPFACDLNEDRPWGFAAA
AAKLSVDSSPFFSNITNTFGATLPKLDVAISADKPSFGLCIEPAIVPASTMAAGSKKEQK
SNESKKPVAATPATTISKSTTSTKETQPAPQPQQRPKPGSGQLRSLYDGLSHFFAASGKS
TSRAKPGAPPPNYAPDRRKRQHAAEKDADSKTTAVAQPKAPKLVAPKQTAAASTAASSTR
SASDGPTRGKKELAKVTRVPRPGIFTPSEESSSSSSCLYTLTGEKPSKMTPSNLVKTAVN
SKRHEQERRRLRGIDGASLVKCAATDARRRQQQQDQQPQQQESTRRRPEGNNRHHPEMAG
GTSTNAAVPATAASASSTTTTTTTTTTTSTTSSTSSTVPKTNPSQLKSAPRACTSATTTT
NTTTNTTTPRATPCSNRKEELVLPQTLPPGVTQKDVELFKDTRDRANRLTLQQSASETRD
EQDENLQPVMVSPGGTGTRNPAAIVFGRYEVETWYSSPFPQEYARLPKLFFCEFCLKYTK
SRAVLDRHMDKCQWRHPPATEIYRCNGLSVFEIDGNVNKIYCQNLCLLAKLFLDHKTLYY
DVEPFLFYAVTKNDKYGCHLIGYFSKEKHCPAQRYNVSCIMTLPQYQRQGFGRFLIEFSY
LLSKVEGIPGTPEKPLSDLGRVSYHSFWKSVVLEYLDSHREAKELKIAEITKETGVSGHD
IATAMQLLGFLRHVPNGPNDSGKHLAVLVDWRKVDAHMAKVRKSTRIQLDPDCLRWIPLL
TQLPNAYQSPEEGDTSSELASPALDQPPPCANKPVAAMPEKIQRVKIRKKIRGRKMGGAH
RRISPIKHKTSPPQRAKLLKEKELKVGDKSSGHVADTEEDIKDETLNESKNIVTTPKTTR
TGTATTPRSALNSIGSPKTPTTSNSNSNSNSNITTSTPAAPLLSSRRSVRTAMKTPAAAS
TATTAPAAETLTAVTVTPPLRKRKHSEVTESEEKDEIVNSRKRTRESWRDKEKEKEKEKE
VKKKDTKTATKEKETKEKPKSVERDSRVKESARLKEREAAAAAKQESPSSRTHRTPPKES
ATLNTNSPVKAKKQSKLDDILMKVSNQKSKFTPTRQAREKRASAAQNANTEEPQQNHRGS
KKEAAADTVKESPASTRRGRPKVDKAAKDSATVSAESAKSADEFVDEPKEVKASKKQLTI
PDMFSSATSNTTASTTASNASQEDVVDSSNKTNSIEENLTMAAISATTENEAPSASPGEY
EGGDEDDGDEEDFVPRSKMTSVIQSLDAAIENSEKNGELDEKETAVGPSEENGVSCNNTE
MAEPEAPENNAMEMEEPVNSLEKSEEALPASDQMSIDKSMGEEILANSTSCNEEIIGDKM
EKESMSVDKSQQLMDDRMSESRVVEPTHSPMETKMESMPSIPSDNRDQQQQQHYAPPVSH
PSVIETGESQLQQQQQQLHQPVIMPQEKVLPVVTEQQHHHHETTQVHSQPEEKLHSPEES
GKTTPHPENPGSVKRTPPSQPDLPSMGVYTPDSTTNSVHSLHYGQCDLDVSQLGLESPTS
IASDLASQNSIERPPSALPTMPSQQSTVSVTSITGGPIQMSAAAAAQQQQHQQQQQQQQQ
QQAAAHPVNLQAQQVQQQQQQQQQYTDCSMPQHVAIQQHQQHQMQHADKNPYHQQQPHTP
QPLQQPRTPQSHTPQSLPTHSPQPMPQQSHTPQPLSQPHTPQPIQTHTPQPMPAQCHTPQ
PLTPQPQLSIAQQQQQQQTNHRNSLVHAHNQQQAQQQAQQQAHQQAQQQAQQQAQQQAQQ
QAQQQAQQQAQQQAQQQAQQAAHQQQQAHSHSSKRTSGSQSSHRSRSAQQGSSSSSRSHR
NTPPASQTQSSSQHATLAAVSHNSHLPPQYQQTMAMSVPGMSHPHSHPSHTAHSHNMAVI
SQGGNYMAVSQAMAFPAQNTYVIQHRGSRSGSHTPCTTATNFYIQTAPMPHSHTPTPATL
STAPGPASGGGNTTTNHQTPNSCSLAKLQQLTNGLEMTPPTPPQAMNLTPPPPIPHTMTP
PQPSRQLSTPPQVPLSYTKNYYNAVNAVPPPPGTPGPPPPSRSTSRSSASASMTPIPQSY
TSESLYRQTLDPSGSCPQMQSAASRVSPNVAINTNLMAAQAAYGYRVAQPTTGYMNQAAA
QLGGFMNQASQLPVGVVNVAAPYAQDPHQQNPTAVYTTHYGYINSGLMQPLNGTMRPR
NT seq 8457 nt NT seq  +upstreamnt  +downstreamnt
atggaggagccggaccccgagacctggaccgcctggttcctcgatgcgatccgcaagatc
cgaagtcagaagcaacggccaagcgtcgagcgcatcgctcacgcgattcggctgcagcac
gactatcacgaggaggtcatcgccgagaacctacagctcgccgtcaaacggggcgatgtg
ctcaagctcttcaacaagggacagtcgtcctacaaggacccgggaggtctgcagtcgaag
ccgctgaaggtgagccgtacgagcgacctatgcaaggtcatcatcaaggcggtgcgtgag
ttgggcgagcgagacggttcgaatctcaagaacatcgagaagtacgtgaggcagagccac
agcgtcgatgaggagcaggagggcgatctcaggacggccctgagactctctgccaagcga
gcagtcgacaggggcctggtgctgcaagagggcaggctcttcaggcagcccgatcggccc
attcatctcgccaagaagttcaacgccgagcgcgagcacaacgatagcctcacgcccaag
ctcccagcgccactgccgatatgcaaggagtgcctgggcgcgacggccgccggcccgaac
aacaacaagcgcaacagcagcggaggcgcgacgaccccgagctcgcagggctcgatcaac
tcgcaggcctcgacggagaagagcctgagccgatgcagcgtgtgcggcgcggccctgcac
acgtcctgcgccccaccggagctggcggtgctgatcgagcgaggcgccagctggtcctgc
gacgactgctcgagcacctgcgccggctgccaggaggagcgagagtctcagagctacctg
gtcaagtgcgccggctgccccaagtgctatcaccccggctgcctcgagcccgcgctcgac
aagcggagcaaggctccctggaggtgtcgacactgtcagaccacgcaccagcagcccgac
gctgccgggaagaagctcgccgaggccaagcagccgctcgcgagcacgcccaccagcgcc
aggaagaggctgagtaacatcagggagaacagaaagtcaatggcatccagcagaaagagc
acgtctttgacggcgggctctgctgcagctgctgcgacgacgccgacatcgacgacggcc
gcgagcacgccatcgggaaagaagagcagtccgtcgcaggctcaggtggacagcagctcg
gacggtaatgcgggtgttgtctcccctcgtcaaccgaaccccctttcctcatcccacagc
cccaaccatcattcccttccacaccaccaccatcacgtacaaagcaccggccagggtggc
ggtggcggcggcaggctgctcgaggagaagaacgaccgaatctccaaggagaagcaaaag
ttcttcaggctcagtgtcttcaacgccaagcacaacaagctcaagcgagccgctgccgcc
gcggccaacaccagcagcagtagcagcaataccagtcacgtctccccggacaaggccagc
aaggctctcgtggcggaggacaaccctacgaggtcgtcccggaacaccggcagcaacgcc
tcttcttcgaagaagtccgtagcgagcgcgaatcgaagggtgcctccgctgcccagtcag
agcgaggacgaggacgaggtcgaggacgacgacgacgacgacgacgacgacgacgacgac
gacgaagagtcgggtgccgatgagaaggttcaggaggaagaggaggaggacgacgatgac
gagtgctcgagcacgtcgagcgacgacgacaactacacctcctgcgaggaggaactgccg
gcatcggaccatcgcctgaggatggtccaaccgaccagcaaacctcctccccctttgcct
cccccgccttcctcgagttcgtcgtctgcgaacagagcccccggcaaaacaagcggaaac
tcgaagggacctttcgcttgcgacctcaatgaggacagaccctggggctttgccgcggcg
gcggcaaagctcagcgtcgacagcagtcccttcttcagcaacataacgaacacgttcggt
gctacgctacccaagctcgacgtggcgatcagcgccgacaagccaagcttcggcctctgc
atcgagcccgcgatagtgccggcgtccacgatggctgcaggcagcaaaaaggaacaaaag
agcaacgagagcaagaagccagtcgccgctactcccgctaccacgattagcaagagtacg
acaagcacgaaagagactcagccggcaccgcagccgcagcagaggccgaagcctggtagt
ggacagttgaggagcctctacgatggcttgagtcactttttcgccgcgtcgggcaagagc
acgagcagagcaaagcctggagcaccgccgcccaactacgcgcccgatcgccgaaaaagg
cagcacgctgccgaaaaggacgcggacagtaaaacgacggcggtggcgcagcccaaggcg
cccaagctcgtggccccgaagcaaaccgccgccgcttctacggcagcctcgtctacgcgg
agcgcgagcgatgggcccacgaggggtaaaaaggaactcgccaaagtcacgagagttccg
agacccggcatcttcacgccctcggaagaaagcagcagcagcagcagctgcctctacaca
ctaacgggcgagaagccctcaaaaatgacgccgtcgaacctcgtcaagacggccgtcaac
agcaagcgacacgagcaggagaggcgacgactacgcggcatcgacggcgcatccctcgtc
aagtgcgccgccaccgacgcccgccgaagacaacagcagcaagatcagcaaccgcagcag
caggagagcacgagaagaaggccagagggcaataatcgccaccaccctgagatggccggt
ggtacgtcaactaacgctgctgtcccagcgacagcggcgagcgcgtcgtctacgacgacg
acgacgacaacgacgacgacaacgtcgacgacctcttctacctcctctaccgttcctaag
actaatcctagccaactcaagtccgctccacgagcctgtactagcgccactaccaccacc
aacaccaccaccaacaccacgacaccccgcgcgacaccctgctccaacaggaaggaggag
ctggtgttgccgcagaccctaccaccaggtgtcacgcagaaggatgtggagctgttcaag
gacacacgcgaccgggccaaccggctcacgttgcagcagagcgcgagcgagacgcgcgac
gaacaggatgagaatctgcaacctgtgatggtcagccctggtggcaccggtacccgcaac
cctgccgccatcgtcttcggtcgctacgaggtcgagacctggtactccagtccttttccg
caggaatacgccaggttgcccaagctattcttctgtgaattctgtctcaagtacactaag
agccgggctgttctcgacaggcacatggacaagtgccagtggaggcatccgcctgccacc
gagatctaccgctgcaatggattatcagtattcgagattgacggcaatgtcaacaagatt
tattgtcaaaacctgtgcctattagctaaactattccttgaccacaagaccctttactac
gacgtcgagccgttcctcttctatgccgtaaccaagaacgataagtacggttgtcatctg
attggctacttcagcaaggagaagcactgtccggctcagcgctacaatgtctcttgcatt
atgacgttgccccagtatcagcgtcagggcttcggtcgcttcttgatcgagttcagctat
ctgctgtccaaggtcgagggcattcccggtactccggagaaaccgctgtcggatctcgga
cgtgtttcgtatcactcgttctggaagagcgttgttctcgagtacctagattctcatcgc
gaggccaaggagcttaagatcgccgagattacgaaggaaacgggtgtctctggacacgat
atcgcaacggcaatgcagctactgggtttcctgcgtcacgttccaaacggtccgaacgat
agtggcaagcacctcgcggttctggtcgactggcgcaaggttgacgctcacatggctaag
gtgcgcaagagcacgcggatccagctggatccggattgtttgcgctggataccattgctc
acgcaattacctaacgcctaccagtctccagaggagggggacacgagctcagaattggcc
tcaccggcattagatcagccaccaccatgtgccaacaaacctgtagctgcgatgccggag
aagattcagcgggttaagattcgcaagaagattcgcggacgaaaaatgggtggcgcacac
aggcgcatttcacctataaagcacaagacgtcgccaccgcagcgggcaaagctgttaaaa
gagaaagaactgaaagtcggggataagagctcggggcacgttgcggataccgaagaagat
atcaaagacgaaactctaaacgagtccaagaatatcgtaacgacgcccaaaaccacgcgg
acggggactgcaactacacctagaagtgctttaaactccatcggttcgcctaagacaccg
acaacgtccaactccaactccaactccaactctaacatcaccacgagtactccagcggct
cctctcttgtcgtctaggcgaagtgtaagaacggcgatgaagaccccggcggcggcaagt
acagcaacgacggctccagctgcggaaacgctgacagccgtgacagtcacgccccctctc
agaaaacgtaaacattccgaagtgactgagtccgaggagaaggatgagattgtcaatagc
aggaagagaactcgcgagtcgtggcgtgataaagagaaggaaaaagaaaaagagaaagag
gtgaagaagaaagataccaagacggctacgaaggagaaggagactaaggaaaaaccaaaa
tcggtagaaagagatagtcgagttaaggaaagcgcaagattgaaagagcgagaagctgct
gcagctgcaaaacaggaatcgcccagctctagaacacatcgaacaccacccaaggagtct
gcaacgctcaatactaatagtcctgtaaaggctaagaagcaaagcaagctggatgacata
ctgatgaaagtctcaaatcaaaagtccaaattcacgccaacgcgacaagcccgcgagaaa
agagctagtgccgctcaaaacgccaacactgaggaaccccaacagaaccatcgcggtagt
aagaaggaagcagctgcggatactgtcaaagaatcaccggcgtcgactaggagaggcagg
ccaaaggttgacaaggcagcaaaagattcagcgactgtgtctgctgaatctgccaagtct
gctgacgagttcgttgacgaacccaaggaggttaaagcatccaagaaacagcttactatt
cctgacatgttttcctcagctacttccaacactactgcaagcaccactgcatcgaatgca
agtcaagaagatgttgtggatagcagcaacaagacaaactctatcgaggaaaatttaacc
atggcggctatctcggccaccacggaaaatgaagcgccaagcgctagtccaggcgaatac
gaaggtggcgacgaggacgatggggatgaagaggattttgtacccagatccaagatgact
agtgtcatacagtctctggacgccgccatcgagaattccgagaagaacggcgaactcgat
gagaaagagaccgctgtaggcccgagcgaagaaaatggtgtatcttgcaataacacggag
atggctgaaccggaggctcctgaaaacaatgccatggaaatggaagagcctgttaatagt
ttagaaaaaagtgaagaagccttgccagcgtcagatcaaatgagcatcgataaatccatg
ggagaagaaatacttgcaaatagcaccagttgcaatgaggaaattatcggcgataagatg
gaaaaggaatcgatgtccgttgacaagagccaacagttgatggatgatcgcatgtcggag
agtcgcgtggttgaaccaacgcatagtccgatggagactaagatggagagcatgccgtcc
ataccaagcgataacagagatcaacagcaacagcagcattacgctcctccagttagtcat
ccaagcgttatcgagacgggcgagagccagctgcagcaacaacagcaacaattgcatcaa
ccagtaattatgccacaagagaaagtattaccagtagttactgaacaacaacaccatcat
cacgagacgacacaggtgcactcacagcccgaggagaagctgcattctccagaggagagt
ggtaagacaacgccgcatccggaaaatccaggttctgtcaagcgtacaccaccttcgcaa
ccggatcttccctctatgggcgtatacacaccagattctacgacaaactccgtgcactct
ttgcactatggtcagtgcgacctggacgtcagtcaattaggtctagaatcgccgacgtcg
atagcaagcgatcttgcctcgcaaaacagcatcgagagacctcctagtgctttgccaaca
atgccaagtcaacagtcaacagtttcagtcacctcaataacgggaggacctattcagatg
agcgcagcagccgctgctcaacaacagcaacatcaacaacaacaacagcaacaacaacaa
caacaggctgccgcacatccagtaaatctccaggcgcaacaggtgcagcaacagcagcag
caacagcagcagtacactgactgctcgatgccgcagcatgtggctattcagcaacatcaa
cagcatcaaatgcagcacgctgataagaatccttaccatcaacagcagccacatacgccg
cagcccctgcaacagccgcgaactccccagtcgcacactccacagagcttaccaacacat
agtccgcagccaatgcctcagcagtcgcatactccacaaccgctgtctcagcctcataca
ccacaacctatacaaactcacacacctcagccaatgcctgctcagtgccacacgccgcag
cctttgacgcctcaaccacaactgtccattgcgcaacagcaacaacagcagcagacaaat
catcgaaacagtcttgtgcacgctcataaccagcaacaggcccaacagcaggcccagcag
caggcacatcagcaggcacagcagcaagcgcagcagcaggcgcaacaacaggcgcaacaa
caggcgcaacaacaagcgcaacaacaggctcaacagcaggcgcaacaacaagcgcaacag
gcggcacaccaacagcaacaagcgcattcgcacagcagtaaaagaactagtggttcacaa
tcttctcatagatcgcggtctgcccagcaaggtagcagcagtagcagtagatcgcatcga
aatacacctcctgcttcgcaaactcagagcagcagtcaacacgccacattagcagcagtt
tctcacaatagtcatctaccgcctcagtaccagcagacaatggcaatgtcagtgcctgga
atgagccatccgcactcccatccaagtcacacggcgcattcgcataacatggccgtgatc
tcgcaaggtggcaattacatggcagtctcacaagctatggctttccccgcgcaaaatact
tatgtcatccaacatcgaggtagtcgttcaggctcgcatacgccctgcaccaccgcaacg
aacttctacattcaaacagcaccaatgccgcattcgcatacaccaacgccggcgaccttg
agcactgcacctggaccagccagtggtggcggtaacaccacgaccaatcatcagactccc
aacagctgtagtctggcgaagctccaacagctaaccaatggattggagatgacaccacca
acgccgcctcaggcgatgaatctgaccccgccgccgcccataccacacacgatgacgcca
ccacagccttctaggcagctatcgacaccacctcaagtgccgctgagttacactaaaaat
tactacaacgctgtgaatgctgtgccaccaccgcctggtacacctggacccccaccaccc
agtcggtctacctccaggtcgtcggcaagcgcctctatgacaccgatccctcaatcttat
accagcgaaagtctctacagacaaacgctggatcccagtggtagctgtccacagatgcag
agcgcggcaagtcgcgtaagtccgaacgttgccataaacacaaacctcatggcagcgcaa
gcagcttacggttacagggttgctcagcctactactggttacatgaatcaggccgcggct
caactcggaggttttatgaaccaagccagtcaattgcctgtcggcgtcgtaaatgttgct
gcaccttatgctcaagatcctcaccagcagaaccctacagccgtttacacaactcattat
ggttacattaatagcggattgatgcagcctctcaatggcacgatgcgaccgcgctag

DBGET integrated database retrieval system