KEGG   Nasonia vitripennis (jewel wasp): 100116786Help
Entry
100116786         CDS       T01081                                 

Definition
uncharacterized LOC100116786
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
2
AA seq 2181 aa AA seqDB search
MEEPDPETWTAWFLDAIRKIRSQKQRPSVERIAHAIRLQHDYHEEVIAENLQLAVKRGDV
LKLFNKGQSSYKDPGGLQSKPLKVSRTSDLCKVIIKAVRELGERDGSNLKNIEKYVRQSH
SVDEEQEGDLRTALRLSAKRAVDRGLVLQEGRLFRQPDRPIHLAKKFNAEREHNDSLTPK
LPAPLPICKECLGATAAGPNNNKRNSSGGATTPSSQGSINSQASTEKSLSRCSVCGAALH
TSCAPPELAVLIERGASWSCDDCSSTCAGCQEERESQSYLVKCAGCPKCYHPGCLEPALD
KRSKAPWRCRHCQTTHQQPDAAGKKLAEAKQPLASTPTSARKRLSNIRENRKSMASSRKS
TSLTAGSAAAAATTPTSTTAASTPSGKKSSPSQAQVDSSSDEELVLPQTLPPGVTQKDVE
LFKDTRDRANRLTLQQSASETRDEQDENLQPVMVSPGGTGTRNPAAIVFGRYEVETWYSS
PFPQEYARLPKLFFCEFCLKYTKSRAVLDRHMDKCQWRHPPATEIYRCNGLSVFEIDGNV
NKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYAVTKNDKYGCHLIGYFSKEKHCPAQRYNV
SCIMTLPQYQRQGFGRFLIEFSYLLSKVEGIPGTPEKPLSDLGRVSYHSFWKSVVLEYLD
SHREAKELKIAEITKETGVSGHDIATAMQLLGFLRHVPNGPNDSGKHLAVLVDWRKVDAH
MAKVRKSTRIQLDPDCLRWIPLLTQLPNAYQSPEEGDTSSELASPALDQPPPCANKPVAA
MPEKIQRVKIRKKIRGRKMGGAHRRISPIKHKTSPPQRAKLLKEKELKVGDKSSGHVADT
EEDIKDETLNESKNIVTTPKTTRTGTATTPRSALNSIGSPKTPTTSNSNSNSNSNITTST
PAAPLLSSRRSVRTAMKTPAAASTATTAPAAETLTAVTVTPPLRKRKHSEVTESEEKDEI
VNSRKRTRESWRDKEKEKEKEKEVKKKDTKTATKEKETKEKPKSVERDSRVKESARLKER
EAAAAAKQESPSSRTHRTPPKESATLNTNSPVKAKKQSKLDDILMKVSNQKSKFTPTRQA
REKRASAAQNANTEEPQQNHRGSKKEAAADTVKESPASTRRGRPKVDKAAKDSATVSAES
AKSADEFVDEPKEVKASKKQLTIPDMFSSATSNTTASTTASNASQEDVVDSSNKTNSIEE
NLTMAAISATTENEAPSASPGEYEGGDEDDGDEEDFVPRSKMTSVIQSLDAAIENSEKNG
ELDEKETAVGPSEENGVSCNNTEMAEPEAPENNAMEMEEPVNSLEKSEEALPASDQMSID
KSMGEEILANSTSCNEEIIGDKMEKESMSVDKSQQLMDDRMSESRVVEPTHSPMETKMES
MPSIPSDNRDQQQQQHYAPPVSHPSVIETGESQLQQQQQQLHQPVIMPQEKVLPVVTEQQ
HHHHETTQVHSQPEEKLHSPEESGKTTPHPENPGSVKRTPPSQPDLPSMGVYTPDSTTNS
VHSLHYGQCDLDVSQLGLESPTSIASDLASQNSIERPPSALPTMPSQQSTVSVTSITGGP
IQMSAAAAAQQQQHQQQQQQQQQQQAAAHPVNLQAQQVQQQQQQQQQYTDCSMPQHVAIQ
QHQQHQMQHADKNPYHQQQPHTPQPLQQPRTPQSHTPQSLPTHSPQPMPQQSHTPQPLSQ
PHTPQPIQTHTPQPMPAQCHTPQPLTPQPQLSIAQQQQQQQTNHRNSLVHAHNQQQAQQQ
AQQQAHQQAQQQAQQQAQQQAQQQAQQQAQQQAQQQAQQQAQQAAHQQQQAHSHSSKRTS
GSQSSHRSRSAQQGSSSSSRSHRNTPPASQTQSSSQHATLAAVSHNSHLPPQYQQTMAMS
VPGMSHPHSHPSHTAHSHNMAVISQGGNYMAVSQAMAFPAQNTYVIQHRGSRSGSHTPCT
TATNFYIQTAPMPHSHTPTPATLSTAPGPASGGGNTTTNHQTPNSCSLAKLQQLTNGLEM
TPPTPPQAMNLTPPPPIPHTMTPPQPSRQLSTPPQVPLSYTKNYYNAVNAVPPPPGTPGP
PPPSRSTSRSSASASMTPIPQSYTSESLYRQTLDPSGSCPQMQSAASRVSPNVAINTNLM
AAQAAYGYRVAQPTTGYMNQAAAQLGGFMNQASQLPVGVVNVAAPYAQDPHQQNPTAVYT
THYGYINSGLMQPLNGTMRPR
NT seq 6546 nt NT seq  +upstreamnt  +downstreamnt
atggaggagccggaccccgagacctggaccgcctggttcctcgatgcgatccgcaagatc
cgaagtcagaagcaacggccaagcgtcgagcgcatcgctcacgcgattcggctgcagcac
gactatcacgaggaggtcatcgccgagaacctacagctcgccgtcaaacggggcgatgtg
ctcaagctcttcaacaagggacagtcgtcctacaaggacccgggaggtctgcagtcgaag
ccgctgaaggtgagccgtacgagcgacctatgcaaggtcatcatcaaggcggtgcgtgag
ttgggcgagcgagacggttcgaatctcaagaacatcgagaagtacgtgaggcagagccac
agcgtcgatgaggagcaggagggcgatctcaggacggccctgagactctctgccaagcga
gcagtcgacaggggcctggtgctgcaagagggcaggctcttcaggcagcccgatcggccc
attcatctcgccaagaagttcaacgccgagcgcgagcacaacgatagcctcacgcccaag
ctcccagcgccactgccgatatgcaaggagtgcctgggcgcgacggccgccggcccgaac
aacaacaagcgcaacagcagcggaggcgcgacgaccccgagctcgcagggctcgatcaac
tcgcaggcctcgacggagaagagcctgagccgatgcagcgtgtgcggcgcggccctgcac
acgtcctgcgccccaccggagctggcggtgctgatcgagcgaggcgccagctggtcctgc
gacgactgctcgagcacctgcgccggctgccaggaggagcgagagtctcagagctacctg
gtcaagtgcgccggctgccccaagtgctatcaccccggctgcctcgagcccgcgctcgac
aagcggagcaaggctccctggaggtgtcgacactgtcagaccacgcaccagcagcccgac
gctgccgggaagaagctcgccgaggccaagcagccgctcgcgagcacgcccaccagcgcc
aggaagaggctgagtaacatcagggagaacagaaagtcaatggcatccagcagaaagagc
acgtctttgacggcgggctctgctgcagctgctgcgacgacgccgacatcgacgacggcc
gcgagcacgccatcgggaaagaagagcagtccgtcgcaggctcaggtggacagcagctcg
gacgaggagctggtgttgccgcagaccctaccaccaggtgtcacgcagaaggatgtggag
ctgttcaaggacacacgcgaccgggccaaccggctcacgttgcagcagagcgcgagcgag
acgcgcgacgaacaggatgagaatctgcaacctgtgatggtcagccctggtggcaccggt
acccgcaaccctgccgccatcgtcttcggtcgctacgaggtcgagacctggtactccagt
ccttttccgcaggaatacgccaggttgcccaagctattcttctgtgaattctgtctcaag
tacactaagagccgggctgttctcgacaggcacatggacaagtgccagtggaggcatccg
cctgccaccgagatctaccgctgcaatggattatcagtattcgagattgacggcaatgtc
aacaagatttattgtcaaaacctgtgcctattagctaaactattccttgaccacaagacc
ctttactacgacgtcgagccgttcctcttctatgccgtaaccaagaacgataagtacggt
tgtcatctgattggctacttcagcaaggagaagcactgtccggctcagcgctacaatgtc
tcttgcattatgacgttgccccagtatcagcgtcagggcttcggtcgcttcttgatcgag
ttcagctatctgctgtccaaggtcgagggcattcccggtactccggagaaaccgctgtcg
gatctcggacgtgtttcgtatcactcgttctggaagagcgttgttctcgagtacctagat
tctcatcgcgaggccaaggagcttaagatcgccgagattacgaaggaaacgggtgtctct
ggacacgatatcgcaacggcaatgcagctactgggtttcctgcgtcacgttccaaacggt
ccgaacgatagtggcaagcacctcgcggttctggtcgactggcgcaaggttgacgctcac
atggctaaggtgcgcaagagcacgcggatccagctggatccggattgtttgcgctggata
ccattgctcacgcaattacctaacgcctaccagtctccagaggagggggacacgagctca
gaattggcctcaccggcattagatcagccaccaccatgtgccaacaaacctgtagctgcg
atgccggagaagattcagcgggttaagattcgcaagaagattcgcggacgaaaaatgggt
ggcgcacacaggcgcatttcacctataaagcacaagacgtcgccaccgcagcgggcaaag
ctgttaaaagagaaagaactgaaagtcggggataagagctcggggcacgttgcggatacc
gaagaagatatcaaagacgaaactctaaacgagtccaagaatatcgtaacgacgcccaaa
accacgcggacggggactgcaactacacctagaagtgctttaaactccatcggttcgcct
aagacaccgacaacgtccaactccaactccaactccaactctaacatcaccacgagtact
ccagcggctcctctcttgtcgtctaggcgaagtgtaagaacggcgatgaagaccccggcg
gcggcaagtacagcaacgacggctccagctgcggaaacgctgacagccgtgacagtcacg
ccccctctcagaaaacgtaaacattccgaagtgactgagtccgaggagaaggatgagatt
gtcaatagcaggaagagaactcgcgagtcgtggcgtgataaagagaaggaaaaagaaaaa
gagaaagaggtgaagaagaaagataccaagacggctacgaaggagaaggagactaaggaa
aaaccaaaatcggtagaaagagatagtcgagttaaggaaagcgcaagattgaaagagcga
gaagctgctgcagctgcaaaacaggaatcgcccagctctagaacacatcgaacaccaccc
aaggagtctgcaacgctcaatactaatagtcctgtaaaggctaagaagcaaagcaagctg
gatgacatactgatgaaagtctcaaatcaaaagtccaaattcacgccaacgcgacaagcc
cgcgagaaaagagctagtgccgctcaaaacgccaacactgaggaaccccaacagaaccat
cgcggtagtaagaaggaagcagctgcggatactgtcaaagaatcaccggcgtcgactagg
agaggcaggccaaaggttgacaaggcagcaaaagattcagcgactgtgtctgctgaatct
gccaagtctgctgacgagttcgttgacgaacccaaggaggttaaagcatccaagaaacag
cttactattcctgacatgttttcctcagctacttccaacactactgcaagcaccactgca
tcgaatgcaagtcaagaagatgttgtggatagcagcaacaagacaaactctatcgaggaa
aatttaaccatggcggctatctcggccaccacggaaaatgaagcgccaagcgctagtcca
ggcgaatacgaaggtggcgacgaggacgatggggatgaagaggattttgtacccagatcc
aagatgactagtgtcatacagtctctggacgccgccatcgagaattccgagaagaacggc
gaactcgatgagaaagagaccgctgtaggcccgagcgaagaaaatggtgtatcttgcaat
aacacggagatggctgaaccggaggctcctgaaaacaatgccatggaaatggaagagcct
gttaatagtttagaaaaaagtgaagaagccttgccagcgtcagatcaaatgagcatcgat
aaatccatgggagaagaaatacttgcaaatagcaccagttgcaatgaggaaattatcggc
gataagatggaaaaggaatcgatgtccgttgacaagagccaacagttgatggatgatcgc
atgtcggagagtcgcgtggttgaaccaacgcatagtccgatggagactaagatggagagc
atgccgtccataccaagcgataacagagatcaacagcaacagcagcattacgctcctcca
gttagtcatccaagcgttatcgagacgggcgagagccagctgcagcaacaacagcaacaa
ttgcatcaaccagtaattatgccacaagagaaagtattaccagtagttactgaacaacaa
caccatcatcacgagacgacacaggtgcactcacagcccgaggagaagctgcattctcca
gaggagagtggtaagacaacgccgcatccggaaaatccaggttctgtcaagcgtacacca
ccttcgcaaccggatcttccctctatgggcgtatacacaccagattctacgacaaactcc
gtgcactctttgcactatggtcagtgcgacctggacgtcagtcaattaggtctagaatcg
ccgacgtcgatagcaagcgatcttgcctcgcaaaacagcatcgagagacctcctagtgct
ttgccaacaatgccaagtcaacagtcaacagtttcagtcacctcaataacgggaggacct
attcagatgagcgcagcagccgctgctcaacaacagcaacatcaacaacaacaacagcaa
caacaacaacaacaggctgccgcacatccagtaaatctccaggcgcaacaggtgcagcaa
cagcagcagcaacagcagcagtacactgactgctcgatgccgcagcatgtggctattcag
caacatcaacagcatcaaatgcagcacgctgataagaatccttaccatcaacagcagcca
catacgccgcagcccctgcaacagccgcgaactccccagtcgcacactccacagagctta
ccaacacatagtccgcagccaatgcctcagcagtcgcatactccacaaccgctgtctcag
cctcatacaccacaacctatacaaactcacacacctcagccaatgcctgctcagtgccac
acgccgcagcctttgacgcctcaaccacaactgtccattgcgcaacagcaacaacagcag
cagacaaatcatcgaaacagtcttgtgcacgctcataaccagcaacaggcccaacagcag
gcccagcagcaggcacatcagcaggcacagcagcaagcgcagcagcaggcgcaacaacag
gcgcaacaacaggcgcaacaacaagcgcaacaacaggctcaacagcaggcgcaacaacaa
gcgcaacaggcggcacaccaacagcaacaagcgcattcgcacagcagtaaaagaactagt
ggttcacaatcttctcatagatcgcggtctgcccagcaaggtagcagcagtagcagtaga
tcgcatcgaaatacacctcctgcttcgcaaactcagagcagcagtcaacacgccacatta
gcagcagtttctcacaatagtcatctaccgcctcagtaccagcagacaatggcaatgtca
gtgcctggaatgagccatccgcactcccatccaagtcacacggcgcattcgcataacatg
gccgtgatctcgcaaggtggcaattacatggcagtctcacaagctatggctttccccgcg
caaaatacttatgtcatccaacatcgaggtagtcgttcaggctcgcatacgccctgcacc
accgcaacgaacttctacattcaaacagcaccaatgccgcattcgcatacaccaacgccg
gcgaccttgagcactgcacctggaccagccagtggtggcggtaacaccacgaccaatcat
cagactcccaacagctgtagtctggcgaagctccaacagctaaccaatggattggagatg
acaccaccaacgccgcctcaggcgatgaatctgaccccgccgccgcccataccacacacg
atgacgccaccacagccttctaggcagctatcgacaccacctcaagtgccgctgagttac
actaaaaattactacaacgctgtgaatgctgtgccaccaccgcctggtacacctggaccc
ccaccacccagtcggtctacctccaggtcgtcggcaagcgcctctatgacaccgatccct
caatcttataccagcgaaagtctctacagacaaacgctggatcccagtggtagctgtcca
cagatgcagagcgcggcaagtcgcgtaagtccgaacgttgccataaacacaaacctcatg
gcagcgcaagcagcttacggttacagggttgctcagcctactactggttacatgaatcag
gccgcggctcaactcggaggttttatgaaccaagccagtcaattgcctgtcggcgtcgta
aatgttgctgcaccttatgctcaagatcctcaccagcagaaccctacagccgtttacaca
actcattatggttacattaatagcggattgatgcagcctctcaatggcacgatgcgaccg
cgctag

DBGET integrated database retrieval system