KEGG   Nasonia vitripennis (jewel wasp): 100117168Help
Entry
100117168         CDS       T01081                                 

Definition
glycogen debranching enzyme-like
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:nvi00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
1
AA seq 1924 aa AA seqDB search
MVALQNLVCDSTRQLFKKIGYFFHRCLTLFWSYPKKKTMENLGFSADTQNDDQVRVLTLN
KGEHQDGTLYKLKKGWVVEFRLGASLLGHNLNIFTNHPLLVGNPFERRTYYQLPWNHESA
FIRVSLAGSFHFYLAEASGEDAGKVIASGYLLVDPELTVGVNNQPLPLDCIQCQTVLSKL
MGPFSTWEEKLRVSRKSGYNMIHFTPIQAIGDSKSAYSLSDQLKLNPSFNDAPNKETSFD
DVEKLITKMREEWNTVSICDIVLNHTANESPFLINNPECSYNCNNCPHLRPSYLLDAILF
ELTIRVSSGEWEHKGIPPVVETEEHLNAIRHALHTYFLPLAKIHELYTVDINEIVSEFLN
IARNQIPQDEPPETHNESIVIIRDPEYRRLKSTIDMQLALKIYNIYRPDCFDEDSRLKRC
AEELRNKLQELNDAATNEIQNHLNAAVENSVAGIRYFRVQADGPRQKEISERNPLVPRYF
TDYGSPRSFVEREDIMYSNSGCYLMAHNGWVMNSDPLKNFADADSHVYIRRELIAWGDSV
KLRYGEKPEDCPALWERMTTYVQQMAKIFDGVRLDNCHSTPIPVAEHMLDAARQVRPDLY
VAAELFTNSDQKDNIFVNRLGITSLIREAMSAWDSHEEGRLVYRYGGEPVGAFIQARHRP
LAPSIAHALFLDQTHDNPSPIEKRSVFDLLPSAALVSMACCASGSNRGYDELVPHHIHVV
DEDRQYTSWTDKEGLAKENAKYVSKKSGIISAKKALNDLHFWLGQNSFSQVFVDQMDVDV
VAVTRHSPTTHESVVLVAFTAFKHPDPNASDLRRHVRPLRVEGVVDEIILEASLAHGEKE
NGIPPFSNPKKYVKNEDYINGYSEYLVDVKEHIQICDSTKVEKVDSGDPKITQLNFINFQ
PGSIITIRVSLHANIKPALESINDLISTLTSPNNSELRAIVSRMNFADLNKALYRCDQEE
RDTTANKFGVYDIPGYGPLVYAGLQGVISLLADIRSNNDLGHPLCGNLRQGNWLIDYTWQ
RLKEDEGTAALGEWLEQACEPFKLIPRYLVPSYFDVIIVNVYSTLLDQCFNLMSSFVKDG
TDFTRLLSLVSVQVGGIIKSAQLPDLSPNLDPPKPSIREVDGKSEQECLTMSAGLPHFTV
GYMRNWGRDTFIALRGLFLLTGRHAEARFIILGYAATLRHGLIPNLLDRGVNARFNCRDA
VWWWLYTIQCYVKEVPNGLKLLSDKVSRLFPTDDSDALPAGEVDETLSDVMQEALTVHFQ
GLCFRERNAGKRIDEHMTDRGFNNQIGVHPETGFVFGGNEANCGTWMDKMGSSEKAGNKG
KPATPRDGSAVEIIGLCHSTLNFLAELYKQNLFPYGSVQRKNRDGSTITWSYKQWADKIK
ESFDTYFYVNEKPTDGELRPDLIHRRGIYKDTHGASQPWADYQLRPNFPVAMVASPNLFK
PEHAWLALKKAEEILLGPLGMKTLDPADWAYDGFYNNANDSNDPKVAHGWNYHQGPEWLW
PIGYFLRARLHYAPLVGGEEELKRTIASTEAIISRHLTEASNNHWRGLPELTNREGEYCA
DSCRTQAWSASAIVEVLHDLDKLKKDLKFDDEQQQEAIAETHAHSPTTAAVDVTRFPTDD
DDTSRTGTHAYADLENLSLDTPPSPSTLPSTVSSSSSFPKPHKDPDPGECTEIEDYYRKY
DADRAKQLIDALPLPRHEICSKCAKFEESPVYSDRFFYKGKPLLAKEITVLNSQNLDKDV
LDFMPIHKIAKPNAAGIFYSIGSSPNAVDLNLEPSILLLEPSISTPKIPKTAKSKNRAYL
HLPLVERGYSRVSEKLGVIQPMRLPLLTSTPPQRFEEKSSCKLNIDEEPEPEVNENRSSL
LMLEPLLLMPSRTTVTAAMDRRRNLASKKRLAHSEHLKLIKIIIAYTLTFLLLVSITFYV
VYFR
NT seq 5775 nt NT seq  +upstreamnt  +downstreamnt
atggttgctctgcagaatctagtgtgtgactccacacgacaattattcaagaagataggg
tatttctttcaccgctgcttgaccttattttggtcttatcccaaaaagaagaccatggaa
aatctcggcttctctgcggatacccagaacgacgaccaagtgcgagtactgactctgaat
aagggagagcaccaggatgggaccctgtacaagcttaaaaaaggatgggtcgtggagttc
agattaggggcatcgcttctgggccacaatctcaacatattcactaatcatcctctactc
gtcggcaacccgttcgagaggcgcacgtactatcagctgccatggaatcacgagtcagct
ttcatacgcgtctcgctggccggctcttttcatttttatctggcagaagcgagtggagag
gacgccggaaaagtgatagcttccggctacttgttggtcgatccggagctaaccgtgggc
gtcaacaaccagccgctgccgctagactgcatacaatgccagacggtcctctcaaagctc
atgggacccttctcaacgtgggaggagaagctcagggtctctcgcaagtcaggctacaac
atgatccacttcacaccgatacaggcgataggagactcaaaatcagcttacagcctcagc
gatcagctgaagctcaacccctcgttcaatgatgcaccgaacaaagagaccagcttcgac
gacgtcgagaagttgattacaaaaatgagagaagagtggaacactgtgagcatttgcgac
atagttttgaatcacacggcgaacgagagtccatttttgataaacaatcccgaatgtagt
tacaactgcaacaactgtccacatctccgtccgtcttatcttttggatgccattttattc
gagttgacaatacgagtgtcgtccggagaatgggagcacaaaggaattcctcccgtcgtc
gagactgaagagcacttgaacgcaatccgtcatgctctgcacacttactttctacctctg
gcgaaaattcacgaactgtatactgtagatatcaacgagatcgtgtccgagtttttgaac
attgctcgcaaccagataccgcaagacgagccacccgaaacccataacgaaagcatcgtt
atcataagggatccagaatatcgccgcttaaagtccactatagatatgcagcttgctttg
aagatctacaatatttatagacccgattgttttgacgaggactcacgactgaaacgctgc
gcggaagaactgagaaacaagttgcaggagttaaacgatgccgcaactaacgaaatccaa
aatcatctcaatgccgcggttgaaaactcggtagccggcattcgatacttcagagtccaa
gcagatgggccaagacagaaagagataagcgaaagaaatccacttgttcctaggtatttc
acggattacggaagtcctagatcgtttgtggaaagagaagacatcatgtactcgaattct
ggatgttacttgatggctcacaacggctgggtcatgaacagcgatcccttgaaaaacttt
gccgatgctgactctcatgtttacataagaagggaattgattgcgtggggcgatagtgtc
aaattaagatatggcgaaaaaccggaagattgccctgctctttgggaacgtatgacgaca
tatgttcagcaaatggctaaaatcttcgacggcgtcagactcgacaattgtcactcgacc
cctattccagtagcagaacacatgttggatgctgctcgtcaagtaagaccagatttgtac
gttgccgctgaactcttcaccaactccgatcagaaagataatattttcgtcaatcgtctt
ggaatcacatcgttgataagagaggccatgtcagcgtgggacagccatgaggaaggccgt
ctggtataccgctatggtggcgagcccgtaggtgcgtttatccaggctcgacatcgtcct
ctggcaccgagtatcgcgcatgctttattccttgatcagacgcatgacaacccgagcccc
atcgagaagcgtagcgtatttgacttattgcccagtgccgcactggtctccatggcctgc
tgtgctagtggcagtaatcgcggttacgacgagctcgtgcctcatcatattcacgttgtc
gatgaagacagacaatatacttcttggacagataaggaaggactggcaaaggaaaatgca
aagtatgttagcaaaaaatcgggaatcatttctgctaaaaaggctctcaatgatctccat
ttttggctgggacagaactccttttctcaagtttttgtcgatcaaatggatgttgatgtg
gtagcggttacaagacattcaccgaccactcacgagagcgtcgtactcgtggcttttacg
gcattcaagcacccggatcccaatgctagcgatttgagaagacatgttagacctttgagg
gtagaaggcgtagtagatgaaattattcttgaagcatccctcgcgcacggagaaaaagaa
aatggtatccctccgttctctaatccgaagaaatacgtaaagaacgaagactacataaac
ggttactctgagtacttggtggacgtcaaggagcacattcaaatctgtgattctacaaaa
gttgaaaaggtcgattccggagatcctaaaataacgcaattgaactttattaatttccag
cccggatcaataatcactattcgggtgtcactccacgcaaacataaagccagctcttgaa
tccatcaatgaccttatctcgaccctcacatctccgaacaattcggaattgcgtgcaatt
gtttcgcgcatgaactttgcggaccttaacaaagcactttataggtgtgatcaagaagag
cgagatacgactgccaataaatttggagtttatgatattcccggttatggcccactagtt
tacgctggtttgcaaggtgtaatttcattgcttgctgatatcagatcgaacaacgatctt
ggtcatccactatgtggcaaccttcgtcaaggcaattggttgatagattatacttggcaa
cgtttgaaggaagatgaaggtactgcagctcttggagagtggctggagcaggcctgcgaa
ccattcaagctaattcctcgttatttagtgcccagttactttgacgtgatcatcgttaac
gtgtattctactctcttagatcaatgctttaatctcatgtctagctttgtgaaagatgga
accgatttcaccagactgctgtcactagtatctgtgcaagttggcggtataataaaatca
gcgcaattgccagatttatcaccgaacctagatccaccgaaacctagcatacgagaggtg
gatggcaaatcagaacaggaatgtttgaccatgtctgctggactaccacactttacagta
ggatacatgagaaactggggacgagatacgtttatcgctttgagaggtctgttcttatta
accggcagacatgcggaggctcgattcatcattctgggatacgccgctacgcttcgtcac
ggtttgataccaaatctcttggacagaggcgtcaacgccagattcaattgccgagatgcc
gtttggtggtggttgtacactattcaatgctatgtcaaagaagtcccaaatggcttaaaa
cttctgtcggacaaagtatctagattgttccctactgacgattcggacgctcttccagcc
ggagaagtggatgaaacactgtcggatgtcatgcaggaagcactgacagttcactttcaa
ggtctgtgcttccgtgagcgcaacgccggtaagcgcatcgacgagcacatgactgatcgt
ggattcaacaatcagataggtgtgcatccagagacgggctttgtatttggcggtaacgag
gccaattgcggcacttggatggacaagatgggctcctcggaaaaggcaggaaacaaaggc
aaacctgccactcccagagacggatctgcggttgaaattattgggctctgtcacagcact
ctcaattttctggcagaattgtacaaacagaatctatttccatatggtagcgtgcagcgg
aaaaatcgcgatggctcaacgataacttggagttacaaacagtgggcggataagataaag
gagagtttcgatacttacttctatgtgaacgagaaacctaccgatggtgaattacgaccg
gacttgattcatcgacgaggaatttacaaagatactcacggagcctcacaaccgtgggca
gattatcaattgcgacctaacttcccagtggctatggttgcttcgccgaacctattcaag
cccgagcacgcctggctggcattaaagaaggccgaagaaatcctccttggtcccctaggc
atgaaaaccctagatcccgctgactgggcctacgatggcttctacaacaatgccaacgac
tcgaatgacccgaaagtagctcacggatggaattatcaccagggaccagagtggctatgg
ccgatcggctactttttgcgagcgcgcttgcactacgcgcccctcgttggtggcgaagag
gagttaaaacggactatcgcctcgaccgaagctatcatctcgagacatctgaccgaagct
tcaaacaaccactggcgtggacttcccgagttaaccaatcgcgagggcgagtattgcgct
gatagctgtcgcactcaggcctggagcgcttccgcaattgtcgaggtcctccacgatttg
gacaagctgaaaaaggatctgaagtttgacgacgagcagcaacaagaagcaatagcagaa
acacacgcgcacagcccgaccactgctgcagtcgatgtcactaggttcccgactgacgac
gacgacaccagccgcacgggaacacacgcatatgccgatctcgaaaacctctcccttgac
actcccccgtcgccctccacgcttccctctaccgtctcttcgagctcatcctttcccaag
cctcacaaagatccagatcccggcgagtgcacagagatcgaggactactacagaaaatat
gacgcagatagagcaaagcaactgatagacgcgctgccgttgccaagacatgagatctgc
tccaaatgtgcgaagtttgaggagagtccggtctacagcgatcggttcttttataaaggc
aagccccttctagctaaggagatcactgtgctgaacagtcagaacctcgacaaggatgtc
ttggactttatgccgatccacaagatcgccaaacccaacgctgcaggtatcttttatagc
atcggctcatcccccaacgccgtcgatcttaaccttgagcccagcatcctactactggag
ccgtccatttcaacgccgaaaatcccaaaaaccgccaaaagcaaaaacagagcttacctt
catcttccacttgtcgaacgaggttatagccgcgtgtccgagaaactcggtgtcattcag
ccaatgcgactaccactgctcacctcaaccccaccgcagagattcgaggagaaatctagc
tgcaaactaaacatagatgaagaaccagagccagaagtcaacgagaacagatcaagcctg
ctgatgctagagccgctgttgctcatgccatccaggactacagtaacggcggcgatggac
cggagacgtaacctggcctccaagaagcgactcgcgcattcggagcatttgaaactcatt
aaaataataatcgcttataccctcactttccttttgctagtgagcataacgttttacgta
gtgtactttaggtga

DBGET integrated database retrieval system