KEGG   Nasonia vitripennis (jewel wasp): 100117225Help
Entry
100117225         CDS       T01081                                 

Definition
guanylate kinase-like
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100117225
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     100117225
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
4
AA seq 221 aa AA seqDB search
MHILTYSQIPLSFKVLRLGLSIMLQKGPRPIVFCGPSGSGKSTLIKLLFNEFPDKFGFSV
SHTTRNPRPGEEDGKHYYFTTKEDMQKQIEQGEFIETATFSGNMYGTSKRAIEDVQRAGK
ICVLDIETEGVKQIKTSSLNPLFIFIKPPSIPELERRLIGRKTETNESLQRRLSSARSEI
EFGEAPGNFDLVIENDNIDKAYQKLKDFILSEINQQNQKIN
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgcacatcttaacgtattcacaaataccattgagctttaaagtgctcagactaggactc
tccatcatgcttcaaaaaggtccccgtccgatagtgttctgtggtccctcaggcagtgga
aaaagtacactgattaaattgttgtttaatgaattcccagacaagtttgggttttccgtg
tctcatactactagaaacccaagacccggtgaagaagatggaaaacattattactttaca
actaaggaagatatgcagaagcaaattgaacaaggagaattcattgaaactgctacattt
agtggaaatatgtatggcacaagcaagcgggccatagaagatgtacaacgagctggcaag
atttgtgttttagacattgaaactgaaggagtcaagcaaatcaagactagttcccttaac
cccttgtttatttttattaagccaccctccatcccagaattggaaagacgtttgattgga
cgtaaaactgaaaccaatgaatcactgcaacgtagattgtccagtgcaagatctgaaatt
gaatttggtgaagccccaggcaactttgacttggtgattgaaaatgataatatagacaag
gcttaccaaaaattgaaagactttattttatcagagatcaatcagcaaaatcagaaaata
aattga

DBGET integrated database retrieval system