KEGG   Nasonia vitripennis (jewel wasp): 100117430Help
Entry
100117430         CDS       T01081                                 

Definition
glutaminase kidney isoform, mitochondrial-like
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100117430
   00330 Arginine and proline metabolism
    100117430
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    100117430
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     100117430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
1
AA seq 660 aa AA seqDB search
MYRDAILHAVRILKTTSKPGTTAGLRRFHTRLQRLAAVPKSTKLGSARYLDASYGSALEL
ENVQRRDYSFIHDSHYMYTRDQDQATNAEDVMFDMFKNEETGLLHVGKFLAALRTTGLRK
NDPRLQELTDNLKKEHIKSGGHEGISHETQKLDREQFRRIITPNIVLISRAFRHQFIIPD
FPGFTKHIEDFYWKCKSNTEGKVASYIPQLARMNPEYWGVSVCTIDGQRFSIGDTTIPFT
LQSCSKPLTYAIALERLGQEVVHKYVGQEPSGRNFNELVLDHNKKPHNPMINAGAILVCS
LLKVLIKPEMTLAEKFDFTMNYFKRLAGGENLGFNNAVFLSEREAADRNYALGFYMREHG
CYPEKTNLRECMDFYFQCCAMEANCESMAVMAATLANGGICPITEEKVLKPDSVRDVLSL
MHSCGMYDYSGQFAFKVGIPAKSGVSGSLLVVIPNVMGICTWSPPLDPLGNSCRGVQFCE
ELVSEFNFHRYDNLKHATNKKDPRRHKYETKGLSIVNLLFSAASGDVTAMRRHRLSGMDM
TLSDYDGRTALHLAASEGHLDCVEFLIEQCGVPHDPKDRWGNRPIDEAETFGHAQVVEYL
KNYEMVRQAELKEKAAANGNGNGESSESGSNNSKEPTQSNKSSPDSIIDPAPTSGQSPLP
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtacagagacgcgattttgcacgccgtcaggatcctgaagacgacgtcgaagccggga
acgaccgccggactccggcgctttcacacgcgcctccagagactagcggcggtgccaaag
tccacgaaactcggctcggcgagatacttagatgcctcttacggaagtgccttggagctc
gaaaatgtgcagcgacgcgattacagcttcattcatgacagccattacatgtatacaaga
gaccaggatcaagcaaccaacgcagaggatgtcatgttcgacatgttcaaaaacgaagag
accggactgctccacgttggaaaattcctagctgcattgagaacgaccggtctgcgaaag
aacgacccgcgactacaggagctcaccgacaatctgaagaaggaacatatcaaatccggc
ggccacgaaggaatatcgcacgagactcagaagctcgatcgagaacagttccgaagaata
atcacgccgaacatagtcctgatctcgcgagccttccgccaccagttcatcatcccggac
ttcccgggcttcaccaagcacatcgaggacttctactggaagtgcaagtccaacaccgag
ggcaaggtcgcctcgtacattccccagttggctcgaatgaatcccgagtactggggcgtc
tcggtctgcacgatagacggccagcgtttcagcatcggcgacaccacaataccattcact
cttcagagctgcagcaaacctctgacctacgcgatagccctcgagagactaggccaggag
gtcgtgcacaagtacgtcgggcaggaaccgtcgggaaggaatttcaacgagctcgtgctc
gatcacaacaaaaaaccgcacaatcccatgatcaacgccggcgcgatcctggtctgctcg
ctgttgaaggtcctgataaagccggaaatgacgctcgctgagaagttcgatttcacgatg
aactacttcaagaggctcgcgggaggcgagaatcttggcttcaacaacgccgtcttcctg
tcggaacgagaggccgctgacagaaattacgcgcttggattttacatgcgcgagcacggc
tgctaccccgagaaaacaaatttgcgagagtgcatggatttctattttcagtgttgcgca
atggaggcgaattgcgaatcgatggcggtaatggcagccactttggcgaacggtggaatc
tgtccaataacggaggagaaggtgctgaaacccgatagcgtccgagatgttctcagtctg
atgcacagctgcgggatgtacgattacagtggtcaatttgccttcaaggtggggatacca
gcgaaatccggtgtctcgggtagcctcctcgtggtcatccccaacgtaatgggcatctgt
acgtggtcgccacctctggatccattgggcaactcctgtcgtggcgttcaattctgcgaa
gagctggtctccgagttcaacttccacaggtacgacaatctcaagcacgcgacgaacaag
aaggacccgcgaagacacaagtacgagaccaagggcctgtccatcgttaatctgctgttc
agtgctgccagtggcgatgtcacagcgatgcgcaggcatcggctgagcggcatggacatg
accctctcggactacgacggccgcacggctttacatctggccgcgagcgagggccatctg
gactgcgtcgaatttctcatcgagcaatgcggtgttccccacgatcccaaggacagatgg
ggcaatcgaccgatcgacgaggcggagacattcggacacgcgcaagtggtcgagtacctg
aagaactacgagatggtgcgtcaggccgaattgaaggaaaaagccgccgccaacggtaac
ggaaacggcgaaagttccgagtcgggcagcaataattcgaaagagccgacgcagagcaac
aaaagctcgccggattcgataatcgacccggcgcccactagcgggcaatcgcccttacct
taa

DBGET integrated database retrieval system