KEGG   Nasonia vitripennis (jewel wasp): 100117680Help
Entry
100117680         CDS       T01081                                 

Definition
mRNA export factor
Orthology
K14298  
mRNA export factor
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100117680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
2
AA seq 356 aa AA seqDB search
MFNQSTALATPATTTSNPMKDFEVVSPPDDSISSLAFSPATIPQNFLVAGSWDCNVRCWE
VEQTGKTVPKSMQSMTGPILDVCWSDDGTKVFMASCDKMVKCWDLASNQTIQVAAHDAPV
KTCHWVKGSNYTCLMTGSWDKTLKFWDTRTPNPMLTINLPERCYCADVDYPMAVVGTAGR
GLIVYQLEGTPHEYKRIESPLKYQHRCVAIFRDKKKVPTGYALGSVEGRVAIQYVNPTNP
KDNFTFKCHRLNGAPNGYQDIYAVNDIAFHPVHGTLATVGSDGTFSFWDKDARTKLKPSE
PMEHPITRCCFNHNGQIFAYSVSYDWSKGYEFYNPMKKNYIFLRSCYDELKPRNTS
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgttcaatcaaagtacagcattggctacaccagccactactacttcaaatcctatgaag
gattttgaagtagtgtcaccaccagatgattccatatcaagcttagcgtttagtccagcc
actattccgcaaaacttccttgtggctggatcttgggattgcaatgttagatgctgggag
gtagaacaaaccggaaagactgtccccaaatcaatgcagagtatgacgggacccattcta
gatgtctgctggagcgatgatggaacaaaagtttttatggcatcatgtgataaaatggtc
aaatgctgggatttggcttctaatcaaaccattcaagtagcagctcatgatgcaccagtc
aaaacttgtcattgggtaaaaggttcaaattacacttgcttgatgacaggctcatgggat
aaaactttgaaattctgggacacccgaactccaaacccaatgttgaccattaatttacca
gaaagatgctattgtgcagatgtagattatcctatggctgtagtaggaacagctggacga
ggattgatagtttatcagttagaaggaactccacatgaatataaacgaattgagtctcca
ttaaaatatcagcatagatgcgttgccatattcagagataagaaaaaggtgccaacggga
tatgccttaggtagtgtggaaggtcgtgttgctattcaatatgtgaacccaacaaatcca
aaagataacttcacatttaaatgtcatcgtttgaacggcgcgccaaacggctatcaagat
atttatgcggtcaatgacattgccttccatcccgttcacggaactttagctacggtagga
agtgatggtacttttagcttttgggataaagatgcacgtacaaaactaaagccctctgaa
cctatggagcaccctatcactcgttgctgttttaaccacaatggtcaaatctttgcttat
tccgtatcttatgattggtcgaaaggctacgaattttacaatccaatgaagaaaaattat
attttccttcgatcttgctatgatgaattgaaacccaggaatacatcgtga

DBGET integrated database retrieval system