KEGG   Nasonia vitripennis (jewel wasp): 100117830Help
Entry
100117830         CDS       T01081                                 

Gene name
RDH54, Rad54b, TID1
Definition
DNA repair and recombination protein RAD54B
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    100117830 (RDH54)
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     100117830 (RDH54)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
2
AA seq 900 aa AA seqDB search
MNRNSRLGGIKFRELDYSKSSPSEKQTNKTPLRSKADVLKLFADASDVPEKENSSDNICT
VEKNDSDDVTVQDVNFEDPFEDESKTERANVEANNVATSSIVKQETKPKIDIVVKEKPKI
QSNVVGTSTARKENTDLKRQQTFSQPSQSSPVADGKKVYNVMVGKISTRKHKQWESDGIL
EVSGKSAVLKDIDGKFMGRTTVKPEAIEEGFRLCIGGKEIEIVELASQEDIDARQSSNEG
NRKTESVEPPEKKAKLSKGFVPVKSGSLHFNYEPLIMPHPPLDVEWCEGNDDKKIHEVSV
DGCLASVLRPHQREGIVFLYKCIMGMNSAHHKGAILADEMGLGKTLQCISLIWTLLKKGP
SGKPVLKRVLIVSPSSLCGNWNKEFKRWLGTMKIAPYVVEGKQKVKDFTKTPRACVMIIG
YEMFVRNIDDINNLNFDLLICDEGHRLKNSEVKTLKFLSQLRCKRRILVTGTPVQNDLTE
FYNLANFVNPGVFGTPGDYKSYYEHKIVASQRATADEDEVALGQERAKELYEKSKSFILR
RTNTLINKYLPQKHELVVFCKPTVEQNNLYSLITDYWFNRSLIDGNVIPLTVITALKKVC
NHPYLFTSEKSNILDEVLPSVPTNLSAINTSYSYSSKVKVVQAIFQAIKRTNEKVVLVSY
FTQTLDFLEKVCCTEGLQFCRLDGHTPAASRTKLVDRFNSKDNSFCRVFLLSAKAGGVGL
NLVGASRLILFDSDWNPANDAQAMARIWRDGQKRSVFIYRLLTTGTIEEKIYQRQISKTG
LSEAVVDANHISSLKLSASELKDLFTLDSQTSSVTHDLMDCSCTGCGDIPYKNEENSASE
DARDCQFDLKKKQPKQQISMNQLLSWQHYKQPICPDLMKELMIQQVQNHITFIFKNSVKK
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaaacagcagattaggaggaataaaatttcgggagttggactacagtaaaagt
tcgccgagcgagaagcaaacgaacaaaactccactgcgaagcaaagctgatgttttgaaa
ctctttgccgatgcaagtgacgttccagaaaaagaaaacagttcggataatatttgtacg
gtcgaaaaaaatgattccgacgacgttactgtccaggacgttaattttgaggatcctttt
gaagatgaaagtaaaacggaaagagctaatgtcgaagcaaataatgtagcaacatcatca
attgttaaacaagagacaaaaccgaaaatcgacattgtggtaaaggaaaaaccaaaaatt
cagtctaacgtggtaggcacgtctacggcaagaaaagaaaataccgacttgaaaaggcaa
caaacattttctcaaccatctcaaagttcacctgttgcagatggaaaaaaagtttacaat
gtcatggttggtaaaatatcgacacgaaagcacaaacaatgggagagtgatgggatactc
gaagtcagtggaaaaagtgctgtattgaaggatattgatggaaaatttatgggtagaacg
actgttaaacctgaagctatcgaagaaggctttagattatgtataggaggaaaggagatt
gagatagtggaattagcttcacaagaagatattgatgcaagacaatcatctaatgaagga
aaccgcaaaactgaatctgtagagccaccagaaaagaaagctaaattatctaaaggattt
gttcctgtgaaatctggaagtttacacttcaattatgaacctcttataatgccccatcca
ccacttgatgtcgaatggtgtgaaggaaacgatgataaaaagatacatgaagtgtccgtt
gatggttgtttagcctctgtattaagacctcatcaacgtgagggaatagtttttctgtat
aaatgtataatgggaatgaatagtgctcaccataaaggtgcaattttagctgatgaaatg
ggtttaggaaaaacactgcaatgtatttcacttatttggacattgttgaaaaaaggtcca
agtggaaaacctgtactgaaaagagtactaatagtatctccaagcagtttatgtggtaat
tggaataaggaatttaagagatggttaggaacaatgaaaatagctccatatgttgtggaa
ggcaaacagaaagtcaaagattttaccaaaactccaagagcttgtgttatgatcattggc
tatgaaatgtttgttagaaatatagatgacataaataatttaaatttcgatttattaata
tgtgatgaaggtcatagattaaagaatagtgaagtaaaaacactaaagtttcttagtcaa
ttgcgttgcaaaagacgaattctggtcacaggtactccagtacaaaatgatttgacagaa
ttttataacttagcaaattttgttaatcctggtgtttttggcacccctggtgattataag
agttattatgaacacaaaattgttgcatctcaaagggcaacagcagatgaagatgaagtt
gcattaggtcaagaaagggctaaagaactatatgaaaaatctaaatcatttattcttagg
cgtacaaatactttgattaataaatatttgcctcaaaagcatgaactagtcgtattttgc
aaaccaacagtggaacaaaataatttatacagcctgataactgactattggtttaacaga
tctcttatagatggaaatgttatacccttaactgtcattactgctttgaaaaaagtgtgc
aatcatccttatttgtttactagtgaaaaaagtaatattttggatgaagttctaccttca
gtgccaaccaatttatctgccataaatacttcttattcatattcgagtaaagttaaagtt
gttcaagcaatatttcaagccattaaaagaacgaatgagaaagttgttctagtatcatac
ttcacacaaaccttagattttttagaaaaagtttgctgcactgaaggattacagttctgc
agattagatggtcatacacctgctgcttcaagaactaaacttgttgatcgatttaactca
aaagataactctttttgtcgagtctttttgttaagtgcaaaagctgggggagttggtttg
aatttagttggagcatcaagattaattttattcgattcagattggaatccagcaaatgat
gctcaagctatggcccgcatttggagagatgggcaaaagagatcagtcttcatttataga
ctgctgactactggtactatagaagaaaaaatatatcaacgacagattagtaaaactgga
ttgagtgaagctgttgtggatgctaatcatatttcatcgttaaagttatcagcaagtgaa
ttgaaggatctgtttacactggacagtcaaacgtcatcagttacccatgatttgatggat
tgttcttgtacagggtgtggagatataccatacaaaaatgaagaaaattctgcaagtgaa
gatgctcgagattgtcaatttgatcttaagaaaaaacaacctaagcaacaaatatcaatg
aatcagcttctcagctggcaacactacaagcaacctatatgtcctgatttaatgaaggaa
ttgatgatacagcaagttcaaaatcacataacatttattttcaaaaattctgtaaaaaag
taa

DBGET integrated database retrieval system