KEGG   Nasonia vitripennis (jewel wasp): 100117862Help
Entry
100117862         CDS       T01081                                 

Definition
annulin-like
Orthology
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100117862
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
2
AA seq 734 aa AA seqDB search
MFYRFYDRYRVFNDRRRKPFPYRFYWENYRNSVLTIVHVDYCVDENGDAHRTSRYELMNR
DDGGARLVVRRGQPFVVDLALSRNYDPAIDGMSIVFTLDGVKRPQYGHGTLVASPVLHPG
ELSEGSWQSVVEAYAENSLRIKVTPAADAIIGKWRMDIDTKRRDSEGAVSFTVDNPFYVI
FNPWCREDAVFMGSEAERQEYVLADSGLIWRGTSNRMRPSVWKYSQFERDILDCALYMVL
ELGKVRVSARNDPVVVSRVLSAAVNSPDDYGVVMGNWSEDFGGGTPPSQWMGSQKILQQY
YRSKKPVKYGQCWVFAGVLATVCRSLGLPCRVVTNYSSAHDTQNSLTVDYFVDENGKIME
ELNSDSIWNFHVWNEVWMKRLDLTPDCHGWQVIDATPQELSEDAYRCGPASVAGVKRAEI
RRPYDNSFVFAEVNADKVFWRYNGPSQPLKLVRKDVHGVGQYISTKAVGRWEREDITHSY
KYPEKSSEERAAMLKALRQSESLFSRYYLNEEFNDIVFNFELRDDIVIGQPFSVVLTVKN
HSYVDTYQVSVILRVETVTYTGKVGEPVKRSDSERFVRPGATDEVRLEVSWAEYGPRLLD
QSAFNISCLATVKDTNFEYFAQDDFRVRKPDIVLELDKDPVVGELLEATARFANPLPIAL
KRGKFLIEGPGLKEQLKLKLAEDVEVGGEAVCRFSMTPLFEGRATIAAKFYSKELDDVDG
FINFTVKLPAYGSE
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgttttacagattctacgatcgctaccgggtcttcaacgaccggaggcgcaagcctttc
ccctacagattctattgggagaactacaggaactcggtgctgacgatcgtgcacgtggac
tactgcgtggacgagaacggggacgcgcaccggacctcgcgctacgagctgatgaaccgc
gacgacggcggcgcccggctggtcgtgcgccgcggccagcccttcgtcgtggacctggcc
ctgtcgcgcaactacgatccggccatcgacggcatgtccatcgtcttcacgctcgacggg
gtcaagaggccgcagtacgggcacggcacgctcgtcgcctcgcccgtgctgcacccgggc
gagctctccgagggctcctggcagagcgtcgtcgaggcctacgccgagaactcgctgcgg
ataaaggtgaccccggccgcggacgctattattggaaagtggaggatggacatcgacacg
aagaggagagactcggagggtgccgtcagtttcaccgtggacaatccgttctacgtgata
ttcaatccttggtgccgagaggacgcggtgttcatgggcagcgaggcggagcggcaggag
tacgtgctggccgacagcgggctgatctggcggggcacgagcaaccgcatgaggccctcc
gtctggaagtactcgcagttcgagcgcgacatcctcgactgcgcgctctacatggtgctc
gagctgggcaaggtccgcgtctcggcgcgcaacgaccccgtcgtcgtgtcccgcgtgctc
tccgcagccgtcaactcgccggacgactacggcgtcgtgatgggcaactggtcggaggac
tttggcggcggcacgccgccctcccagtggatgggctcgcagaagatcctgcagcagtac
taccgcagcaagaagcccgtcaagtacggccagtgctgggtcttcgcgggcgtgctcgcg
accgtctgccggagcctcgggctgccctgccgcgtcgtcaccaactactcgagcgcccac
gacacgcagaacagcctgaccgtcgactacttcgtcgacgagaacggcaagatcatggag
gagctcaacagcgattccatatggaacttccacgtgtggaacgaggtgtggatgaagagg
ctggacctcacgccggactgccacggctggcaggtgatcgacgctacgccccaggagctg
agcgaggacgcctaccgctgcggcccggcctccgtggcgggcgtcaagcgcgccgagatt
cgccggccctacgacaacagcttcgtcttcgccgaggtcaacgcggacaaggtgttctgg
cggtacaacgggccctcccagccgctcaagctcgtgcggaaggacgtgcacggggtcggg
cagtacatcagcaccaaggcggtcggcagatgggagcgcgaggacatcacgcacagctac
aagtacccggagaagtcgagcgaggagcgggctgccatgctgaaggcgctgcgccagagc
gagtccctcttcagccggtactacctgaacgaggagttcaacgacatcgtcttcaacttt
gagctgcgggacgacatcgtcatcggccagcctttcagcgtcgtcctgacggtgaagaac
cacagctacgtggacacgtaccaggtctcggtgatactgcgcgtggagacggtcacgtac
accggcaaagtgggcgagccggtgaagaggtccgacagcgagcgcttcgtccggcccggc
gcgaccgacgaggtgcggctcgaggtgtcctgggccgagtacgggccgaggctcctcgac
cagtcggccttcaacatctcctgcctggccaccgtcaaggacaccaactttgagtacttt
gcccaggacgactttcgcgtgaggaagcccgacatcgtgctggagctcgacaaggatccc
gtagtcggcgagctgctggaagccacggcccgcttcgcgaaccccctgccgatagcgctg
aagcggggcaagttcttgatcgagggcccgggcctgaaggagcagctcaagctcaagctc
gcggaggacgtggaggtgggcggcgaggccgtctgcaggttcagcatgaccccgctgttc
gagggcagggccaccatagccgccaagttctactcgaaggagctcgacgacgttgacggc
ttcatcaacttcacggtcaagctgccggcctacggaagcgagtag

DBGET integrated database retrieval system