KEGG   Nasonia vitripennis (jewel wasp): 100117952Help
Entry
100117952         CDS       T01081                                 

Definition
ras-specific guanine nucleotide-releasing factor 2-like
Orthology
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
nvi  Nasonia vitripennis (jewel wasp)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
2
AA seq 1516 aa AA seqDB search
MLSEKAHYDHSAAGYLHKRTADSAKWQLRWFVLYQNILFYYENEACSRPSGVILLEGCYC
DRLITAKGKDSDKQICFAISYRRENQRQYELKASTEADCKMWIDAIREASFNKMLLQKEE
LEQKHLHLLQIVESEKTAKWQYTQQCEELTSEIKKLRAELCALKKELRPSMTSAYGSRGT
FQRTVSQSISGGGISGLINAGSLGMQGTSGCANATDFKGISEGSTEMQKIKKVQSFFRGW
LCRRRWKQIVEQYIKSPHAESMRKRNSLVFQMVEAEEEYTEQMEVLVSCFLRPFKMAASS
KKPPCSHEDVNSIFLNSETVLFLHQIFLKGLTSRMESWPTLVLGDLFDMLLPMLSIYQEY
VRNHHYSLQVLTECKQSSSSFAALLIRLENKTACHGRSLETFLTYPMHQIPRYIITLHEL
LAHTPHDHVERKSLQNARQQLEDLSRQMHDEVSETENLRKNLAVERMIAEGCDILLDVNQ
VFVRQGALIQISERPKGARSRLSATFGGKGSTDKETLRQCFLFSNHLILTTRQSDDDGRL
NLVPQIGKIPLSDAVLVEDPSEQTVADDDELSVCSLSSGISESSGSGSTTVTTTNASQLQ
NRDFKIILDLKIGGENHQVTVHLVAPTMQEKAAWISDISQCMDNVHFNDLLHGSLSDTSS
VTMPQSIRNDPKLFKDDIDIRFSRTLNSCKVPQIRYATPDRLLQRLTDLRFLSIDFLNTF
LLTYRVFTDGVTVLEALKKVFYDAEPPDAHMPSGSLVSLDVSGLHTGESHNFLDDRRRSS
STPRRTSGASSVSGYGSEVSDSRETGNSNAFESTASTFMANTKPHWRTTYKKQDEQQLGL
ISETPIGISRNPSVQPPMTLSDKQSPATSRKVSIRVSDKSTSEDDGCHLTIPKVIAGSSS
AETLTDVTVISAPSSPSNLSSVTLVGSTGSGSGSGSDRSPQDSAEIVYSRGVSEETEDTP
IATGDNLKDEVQFTYEDVGPLSPKTFKPDHVKKFPLNRPPRNKRLESDKEEKSWTDDETT
PLAESCQPTIHRFNNPRNHHTYSDHRASIASAPPSTTRSGSISTITGNYWTSRRSIQDCE
LNSDGQRGSYQHDIPQSSSKAGVCITSFRQSHRSNGPDTIWSSTSTAATAFAIATSASSN
PPDRTSIRCDTNNRGSYREKNRRKESVMSTAATMRVLNVLRHWVSKHAQDFELDNKLKNL
TIEFLEDIIYSPNLLPAEHKAASQLLRLITKEETDSNKVDLKKLLTPPLTPTKESIETLS
ALEIAEQMTYLDHQIFISIASEEFLGQAWMKTDKATRAPHITLMTKRFNEVSQLVVSEII
RRSNMQARVGAIEKWAAVADISRVLHNYNGVLQICAAFTNSSVYRLKKTWEKVSKTTKQT
IERLQNIVSSEHRFRNLRDALHRCDPPCIPYLGLYLTDLSFIEEGTPNFTDDGLLNFSKM
RMIAHVIREIRHFQQTPYKIELITKVTNYLLDSSLLLEEEDLYRMSLEIEPRTSRLSSAA
LIGIPPNIGASLKRDN
NT seq 4551 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcggaaaaagctcattacgatcactcggcagctggttatttgcataagcgcacc
gcagactctgctaaatggcagttacgctggtttgttctctatcagaatattcttttctat
tacgagaatgaagcgtgttcacgaccaagcggcgttatcttactagaaggatgttactgt
gatcgtttgattacagcgaaaggcaaagattcggacaagcagatatgctttgcaatctcg
tatagaagggaaaaccagagacaatatgaattgaaagcgtcaacggaggcagactgcaaa
atgtggattgatgcgatacgagaggcaagctttaacaaaatgctcctgcaaaaagaagag
ctggagcagaaacacttacacctgttacaaattgttgaaagcgaaaaaactgctaaatgg
cagtacacccagcagtgcgaagaacttacatcggagatcaagaaactacgtgccgagcta
tgcgctttgaaaaaggaacttcgtccaagtatgacaagtgcttacggttcccgtggtact
ttccaacgcacagtatcgcaaagtattagcggaggcggtatctccggattaataaatgcg
ggtagtctgggcatgcaaggaacttcggggtgcgcaaacgcaactgacttcaaaggtata
tccgaaggtagcaccgagatgcagaaaatcaagaaagttcaaagtttcttcaggggctgg
ttgtgtagacggcgctggaaacaaattgttgagcaatatatcaagagcccacacgctgag
agcatgaggaaaagaaacagcttagtatttcaaatggttgaagcagaagaagagtatact
gaacaaatggaagtattagttagttgttttctgaggccatttaaaatggccgctagctca
aagaagccaccgtgcagtcatgaggatgttaatagtatatttttaaacagtgaaactgta
ctctttttgcatcaaatttttctcaaaggtttgacttctcgcatggaaagttggccaact
ttggttctaggcgatttgtttgacatgcttttacctatgctatcaatctaccaggagtat
gtgagaaatcatcattacagtctgcaagtacttaccgagtgtaagcagtcatcgtcttca
ttcgcagcgcttttaatccgtcttgaaaacaaaactgcatgtcacggtagatctctcgag
acttttctaacttatccgatgcatcagataccccgttatattattacgcttcatgagctt
ttagctcatactccgcatgatcatgtagagcgcaaaagtctgcagaatgcccgtcagcaa
ttagaggatctctcaagacaaatgcacgatgaggtcagcgaaacggagaatttacgaaaa
aatttagcagttgaaagaatgatcgctgaaggctgtgacattttacttgacgttaatcaa
gtcttcgtcagacaaggggcactcatacaaatttcagaaagaccaaagggggctcgaagt
cgattaagcgctacttttggagggaaaggtagcacggataaggagactttaagacaatgt
tttttgttctctaatcatttaatattgacaactcgtcagtcagatgatgatggtcgcctt
aatcttgtgccgcaaataggcaaaataccactttctgatgcggtgttagtagaagatccg
agtgaacaaactgttgcagatgatgatgagttatcagtatgttcactatcaagtgggatt
agtgaaagcagtggaagcggaagtacaactgtaacaacaactaatgcatctcaattacag
aatcgagatttcaaaattatccttgatttaaaaattggaggagaaaatcatcaagtcacg
gttcatctagttgcgccaacaatgcaggaaaaagctgcttggataagtgacataagccag
tgcatggacaatgtgcatttcaatgatttgttacatggctcattatcggatacgagttct
gttacgatgcctcaatctattagaaatgacccaaaactttttaaggatgacatagatata
cgtttcagccgtactcttaattcatgtaaagtaccgcaaattcgatatgcaactccagat
cgactcttgcaacggctcaccgacctgcgatttctcagtatagactttttaaatacgttt
ctcttaacataccgtgtctttactgatggtgtcactgtactcgaggcactaaagaaagtt
ttttacgacgctgaaccccccgacgctcatatgcccagtggttctttggtatcacttgat
gtttctggactgcatacgggagaatcacacaacttcttggatgatcgaagaagaagcagt
tcaactcctagacgaacaagtggtgccagttctgtttccgggtacggatcagaagtgagt
gatagtcgagaaacaggaaactccaatgcatttgaatcaactgcaagtacttttatggcc
aacactaagcctcactggcgcactacctacaaaaaacaagatgaacagcaactgggtttg
atttctgaaacaccaataggaataagtcgaaaccccagtgtacagccaccgatgacacta
tccgataaacaatcaccagctacttcgcgaaaagttagcattcgagtaagcgataaaagc
acttcggaagacgacggatgtcatttgactattccgaaagtaattgctggatcgtccagt
gcagaaacgcttacagatgtaacagtcatcagtgcaccatcgtctccaagtaatttgagt
tccgtaactttagtcggttctacaggatcaggctctggatcaggttcagacagaagtcct
caagatagcgcggaaattgtttactcgcgtggtgtttctgaagagactgaagatactcct
attgccacaggagataatttaaaagatgaagtacaatttacgtatgaagatgtcggccca
ctatcacctaagaccttcaagccggatcatgtgaaaaaatttccactaaaccgtccacca
cgaaataaacgtttagaatctgataaagaagaaaaaagttggactgatgatgaaacaaca
ccattagcggagtcgtgtcaacctaccatacaccgtttcaataatcctcgtaatcatcac
acgtattctgatcatcgagcatcaattgcttctgctcctccttcaaccacaagaagtgga
tcgatatcgaccatcacagggaattattggacaagtaggcgttccattcaagattgtgaa
cttaactccgacggtcaaaggggttcataccaacatgacatacctcaatcctcgagcaaa
gctggtgtctgtatcactagctttcgtcaaagtcatagaagcaatggacctgatacaatc
tggagtagcacgtctacagctgcaacagcatttgccatagccacatcagcatcaagtaat
cctcctgatagaacgtcaattcgctgtgatactaacaaccgaggctcatatcgagaaaaa
aataggcggaaggaatcagtaatgtcaacagcagccaccatgcgcgtgcttaacgtgtta
cgccattgggtgtcaaaacatgcgcaagatttcgagttagataataagttaaaaaacttg
acaatcgagtttttggaagatattatttatagcccaaatttgttgccagcggaacataag
gcagcaagccagctcttaagattgatcacaaaagaagaaactgacagcaacaaagtcgat
cttaagaaattattaacaccacctttgacaccaacaaaagaaagcattgaaactttatca
gcccttgaaattgctgaacaaatgacttatttggatcatcaaattttcatctcaattgca
agcgaagaatttttaggccaagcttggatgaaaacagacaaagctacaagagcacctcat
ataacgttaatgaccaaacggtttaatgaagtatcgcagttagtagtatctgaaattata
cgtagatcgaatatgcaagcacgtgttggtgctatagaaaaatgggcagctgttgcagat
ataagtagagtactgcataattacaatggagtattgcaaatttgtgcagcttttacaaat
agcagtgtttatcgactgaaaaaaacatgggaaaaagtttcaaaaacgacaaaacagaca
attgagcgattgcagaatattgtctcatcggaacacagatttcgaaacttaagggatgcc
ttgcacagatgtgaccctccatgcattccgtatcttggattatatctgacggatctctca
tttatcgaagaaggcacacctaactttacggatgatggtctactcaatttttccaaaatg
agaatgattgcccatgtgatacgtgaaattcgacactttcaacaaactccgtacaaaatt
gaattaattacaaaagttactaattatctattagattcttcacttttattagaagaagaa
gatttgtatagaatgtctctagaaatagaaccaagaacatctaggctaagtagcgctgca
ttgattggcattccaccaaatattggtgcaagtttgaaaagagataattaa

DBGET integrated database retrieval system