KEGG   Nasonia vitripennis (jewel wasp): 100118315Help
Entry
100118315         CDS       T01081                                 

Definition
cytochrome c-like
Orthology
K08738  
cytochrome c
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100118315
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
2
AA seq 108 aa AA seqDB search
MGVPAGDVEKGKKIFVQRCAQCHTIDAGGKHKVGPNLHGLIGRKTGQAPGYAYTDANKAK
GITWNKDTLFEYLENPKKYIPGTKMVFAGLKKPQERGDLIAYIESASK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtcccagctggtgatgtcgagaagggaaagaagatcttcgttcagaggtgtgct
cagtgccacactattgacgccggtggcaaacacaaagttggccccaatctccatggtttg
attggcagaaaaactggtcaggctccgggctatgcctacacagatgccaacaaggctaag
ggaatcacctggaacaaagataccctctttgagtatcttgagaacccgaagaaatacatt
ccgggcacgaagatggtgttcgctggcttgaaaaagccacaagagcgaggagatctcatt
gcttacatcgaatcggctagcaagtaa

DBGET integrated database retrieval system