KEGG   Nasonia vitripennis (jewel wasp): 100118360Help
Entry
100118360         CDS       T01081                                 

Gene name
TOR
Definition
rapamycin
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    100118360 (TOR)
Protein kinases [BR:nvi01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   100118360 (TOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
3
AA seq 2478 aa AA seqDB search
MTSTLVLQFVQRLKSKHEDVRNKAARELCLYVKTELREATQEEITAFMDEFNHHIFEMVS
GSDINEKKGGILAIVCLIGADVGNINTRTIRFANYLRNLLPSSDIGVMELAAKTVGKLAL
VSGTFTAEYVEFEVKRAFEWLSGDRNENKRHAAVLVLKELAVSMPTYFFQHITQFFELIF
KAVCDPKPAIREGAVEALRAALVLTAQRETAKQTQKPTWYKLCYEEIVAGFEEVYVREKS
FNRDDRMHGSLLILNELLRCSNLQWERLYEDLMERLSCSSQPTDNDILSLMPRLKTSLMS
KWTASAPQSSLQSVQHNLHPVHESNACRSLMLEKLDEINADVMNQRHCRNSHIQNALMTL
LPRLAAFNKEKFVQDNLRECMHYLIVSLRGREKDRAAAFTTIGLIAVAVDEAIKPYLPKI
MDVIKSSLPSKETPNKKRSSALEPAVFVCITLLGHAVKQTITSDVRDLLEPMLATGLSPI
LTTSLRELAHSVPSLKPDISQGLLRMLSQVLMYKPLRHPGAPWTATSPVSAPPTEIDVAS
TVLGLRTLGTFNFDGNPLLQFVRRCADYFLTWEEPEVRLEAVKTCSRLLRLALGQPGPTV
TSTVSTVLGKLLVVGITDTDSDVRYWVLASLDEPFDIHLAQAESLSCLFVAMNDEVFEIR
ELAIRTIGRLSGMNPAYVMPSLRKALIQFLTELEHSGMGRNKEQAARMLDHLVVSAPRLI
RPYMEPVLKVLVPKLKETETNPGVVLAVLRAVGDLAEVSGAEMQPWMPELLAILLEMLVD
ASSPEKRGVALWVLGQLVGSTGHVVRPYTQYPSLLDVLLNFLKTEQQPVVRRETIRVLGL
LGALDPYKHKMNLGQISSPQLEALSSRPSADARPEAGDELSTSEMLVNMPSATLEEYYPA
VAIATLMRIIREPTLAQHHTMVVQAVTFIFKSLGIKCVPYISQVMPSFLNVLRTADVGFR
EYLFQQLAILIAIVKHHIRNYLDDIFALVQEFWTWNSPLQGTLIHLVEHIAVALGAEFKI
YLPRLMPQILRVLSHDTSKERQVTVKLLLALQKFAGNLDNYLHLVLPPVVRLFQTSPDCP
VAVSRCALETVEQLAESLDFTDFASRIVQPLVRTLDQCSELRAPACETLCALLLQLGPKF
HIFLPLVQRVMVRHRIVHPRFESLVDKVQSASRLGGPGRFEVAEHDHLLLSGAKQRQARS
KSQRAELGLASAADTTVIKKLNVSASNLQKAWTATRRVSKDDWLEWLRSLSIGLLKESPS
PALRSCWALAQTYSQLPRDLFNAAFVSCWSELDESHRTELVATLQQALMVPDIPEISQTI
LNLAEFMEHCDKGPLPLDSKVLGERAMHCRAYAKALHYKEDEYHKGRSGAVFESLISINN
KLQQKEAAEGLLEYVMNQQQENNKQELKVQVRWYEKLHNWDKALHLYRERLEVDAQDVES
TLGEMRCLEALGEWGQLHEVAMRQWSSHTQETKQRMARMAAAAAWGLNQWESMEKHVALI
PKETQDGAFYRAVLAIHDEQYDLAHKLIDNARDLLDTELTAMAGESYQRAYNAMVEVQKL
AELEEVIQYKLVPERRATIKSMWWERLQGGQRIVEDWQKIIQVHTLVISPQDDMYTWLKY
ASLCRKSGNLALCHKTLVMLLGVDPSTARPDQALPIQHPQVTFAYCKHMWVDGKRDAAYG
QLQRFVRTFLPGQQQQQQQPAEDERQLEARKRLLARCYLKLGEWLEALQGINEDSIPNVL
SYYAHATKHDPSWYKAWHAFAYTNFEAVLFYKHQQTETAFNEQQQQQQNGGPNGANVLAN
GAAKSQLSSQFITRFTVPALEGFIRSINLSNGNSLQDTLRLLTLWFEYGQWPEVYEAIIE
GIRLIEINTWLQVIPQLIARIDTPRALVGRCIHNLLVDIGKTHPQALVYPLTVASKSASH
ARKTAANKILNSMSEHSPTLVQQAKMVSDELIRVAILWHELWHEGLEEASRLYFGERNVK
GMFDTLEPLHAMLERGPQTLKETSFNQAYGRDLMEAQDWCHRYKVSGNVRDLNQAWDLYY
HVFRRISRQLPQLTSLELQYVSPKLLLCRDLELAVPGSYQPGQPVIRIGSINSSLQVITS
KQRPRKLCVKGSNGKDYMFLLKGHEDLRQDERVMQLFGLVNTLLLHDPDTFRRNLTIQRY
AVIPLSTNSGLIGWVPHCDTLHTLIRDYREKKKILLNIEHRIMLRMAPDYDHLMLMQKVE
VFEHALEHTCGDDLARLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLM
LDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLINAMEVTGIEGTYRRTCESVMS
VLHRNKDSLMAVLEAFVYDPLLNWRLMDNAAPKGKRSDAQGMSTSSSQEHGDMLDSLTAT
FPKKGVPCSIENGGDSNQPEALNKKALQIINRVRDKLTGRDFSHEETLSVQRQVDLLIQQ
ATNNENLCQCYIGWCPFW
NT seq 7437 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtacgcttgttttacaattcgtccagcggctcaagtcaaagcatgaggatgtc
agaaataaagcagcccgtgagctctgtctctatgtcaagacagagctacgcgaggccaca
caagaggaaattacagcttttatggatgagttcaatcaccacatatttgagatggtttct
ggctcagacatcaacgagaaaaaaggtggtatcctggcaatagtatgcctcattggtgca
gatgtaggcaacatcaatactcgcaccattcgatttgccaactatctgcgaaaccttctg
ccttccagtgacattggagttatggagttggctgccaaaacagttggcaaactagctctg
gtttctggcacctttactgctgagtatgttgaattcgaagtcaagagggcctttgaatgg
cttagtggtgatagaaatgagaacaagagacacgcagcagttttggttctcaaagagcta
gcagtctctatgcccacatattttttccagcatattacccagttctttgaattgatcttt
aaagcagtctgtgaccctaagccagccattcgtgaaggtgctgtagaagccctccgcgca
gctctagtcttgacagcacaacgtgaaactgccaagcagacacagaaacccacatggtac
aagttgtgctatgaagagatagttgcaggctttgaggaggtttatgtccgggagaagagc
ttcaatcgggatgatcgaatgcacggctcattgctaattctcaatgagctgttgcgctgt
agtaatctacaatgggagcggctttatgaagacctcatggagcggctcagctgttccagc
cagccgaccgacaatgatatcctgtcattgatgccgagattaaagacgagcctcatgtca
aagtggacggcctcagctcctcagagttcgttgcagagtgttcaacacaatctccatcca
gttcacgagtcgaacgcctgtcggagtttgatgctggagaaactcgatgaaatcaacgca
gacgtgatgaaccagcgccactgccgcaactcgcacatacagaacgcgctcatgactctg
ctaccaagattagcggccttcaacaaggaaaaatttgttcaggacaatctacgcgagtgc
atgcattatctaattgtcagcctgaggggcagagagaaggacagagcagctgcctttacc
acgatcgggttgatagctgtagccgttgacgaggccatcaagccttacttacccaagatt
atggacgtgattaaaagctcgctaccgtccaaagagacacccaacaaaaagaggagctct
gctctcgaacctgcggtttttgtttgcattacactgctgggacatgctgtgaaacagacc
atcacgtcggatgtgagggatttgctggagccgatgctggctaccgggttgtcgccgatt
ctcaccacctccttgagagaactggcgcatagcgtgccttccttgaagcctgatatatct
cagggcctactcaggatgttgtcacaggtgctgatgtacaagcctcttcgtcatccaggt
gcaccttggacagccacaagtcccgtttctgccccacctactgagatcgatgtagcttcc
acggtcttaggtcttcgcacccttggtaccttcaacttcgatggaaatccattattacag
ttcgtgcgtcgttgtgccgactacttcctcacatgggaagaaccggaggtacgtctcgag
gccgtcaaaacgtgctcgagactgctgagattagcgcttggtcaacccggacctactgtt
actagtaccgtatctactgtgcttgggaaattgttagtcgtgggaatcacggataccgat
tcggatgttagatactgggtgctggcgtcgctggatgagccatttgatattcatctagca
caagcagagagtctctcatgtttgtttgtcgctatgaatgacgaggtttttgaaattcgg
gaattagctattcgtacaatcggtcggctgagcggcatgaatccagcctacgtgatgcca
tcccttcgtaaagctctcatacagttcctcaccgagctcgaacactcgggtatgggtcgc
aacaaggagcaggcagcccgtatgctggatcatctagtcgtctcagcaccgagactcatc
cgaccctacatggaaccggtgctcaaagttttggtacccaagctaaaggaaaccgaaact
aatccaggagttgtgctggcagttttgagagcagttggagatttggcagaggttagcggc
gctgagatgcagccctggatgcctgagctgctcgcaatattgctagagatgctagtggac
gcgtcgtcgccggaaaagagaggtgttgcactgtgggtcttgggtcagcttgttggtagt
acgggtcatgtagtgcgaccgtatacacagtacccatcgctgctcgatgttcttctgaac
ttcctcaagaccgagcaacagcccgtcgttcgtcgtgaaactatccgtgtacttggtctt
ttaggcgcgctcgacccctacaagcacaaaatgaaccttggacagatatcatctccacag
ctcgaagctctgagctctcgaccgtctgccgatgctcgccctgaagctggtgacgagctt
agcaccagtgagatgctggtcaatatgccctcggctaccctggaggagtactatccagcc
gtagccatcgcaaccctcatgcgcattatccgcgagccaactctcgcgcagcatcacact
atggttgtccaagccgtcactttcattttcaagagtcttggtattaaatgcgtgccatat
atatcccaagtgatgccgagttttcttaacgtgcttcggactgcagatgtcggattccgg
gagtatctcttccagcagctcgctattctcattgctatcgtcaagcatcatattcgcaac
tacctcgatgacatattcgcgcttgtgcaagagttctggacgtggaacagtccgcttcaa
ggcacgctcattcatctagtcgaacacatcgctgtggctttaggagccgaatttaagata
tatcttcctcgcctgatgcctcaaatactgcgagtcctgagtcatgacacaagcaaagaa
cgccaggtcacggtgaaactgttactcgctttgcaaaagttcgccggaaacctcgacaat
tacctgcacttggtcttaccacctgtagtccgactcttccagacgagtccggattgcccg
gtcgctgtcagtcggtgtgctctggaaacagtcgaacaactagccgaaagccttgacttt
acagactttgcctcccgcatcgtacagccgctcgttcgaacgctggatcagtgttccgag
cttcgagctccggcctgcgagactctgtgcgccttattgctgcaattggggcccaagttc
cacatcttcttgccacttgttcagcgtgtcatggtacggcataggatcgtccatccacga
tttgagagtttagtagacaaagtgcaaagcgcatctagattaggaggcccaggacgtttt
gaagtagccgagcacgatcacctgttgctcagtggggccaaacagcgccaggccagaagt
aagagtcagcgcgcggaattgggcctagctagtgctgcagatacaaccgtcatcaagaag
ctcaacgtttctgcatcgaatcttcaaaaagcctggacagctactagacgcgtgtccaag
gacgactggctcgagtggcttcgcagcctctccattggtctcttaaaagaatccccgtcg
ccggccttacgttcctgctgggctctggcccaaacctattcacagctaccgcgagacctc
ttcaacgcggcttttgtctcctgctggagcgaactcgacgagtcccaccgcaccgagctc
gtggctactcttcaacaagctctcatggttcccgatatacccgagatcagtcagacaatc
ctaaatctcgccgagtttatggaacattgtgataagggaccgttacctttggatagtaaa
gtcttgggtgaacgagcgatgcattgtcgggcatacgctaaggcgctccactacaaagag
gacgaataccacaagggccgcagcggtgctgtattcgagtcactcatcagcattaacaac
aaattacagcagaaagaggctgcggaaggtctactcgagtacgttatgaatcagcagcaa
gagaacaacaagcaagagctgaaggtgcaggttcgctggtacgagaaactccataactgg
gacaaggctttgcatctgtatagggagaggttggaggttgatgcgcaagacgttgagtcg
actttgggagagatgcggtgtttggaagctttgggagaatggggacaactgcacgaggtg
gcgatgagacaatggagttcgcatacccaagagactaaacagcgcatggccagaatggca
gcggcggctgcctgggggttgaaccagtgggagagcatggaaaagcacgtggcgctgatt
cccaaagaaactcaagacggagctttctacagagctgtgttggcaattcacgacgagcaa
tatgacctggcgcacaagttgatagacaatgcgagagacttactggacaccgaattgaca
gccatggctggcgagagttatcagagagcttacaacgcaatggtcgaggtacagaagctc
gcggagctcgaggaggtgatacagtacaagctcgtaccggaaagacgagcgaccatcaag
tccatgtggtgggagcgattgcagggtggtcaacggatcgtagaggactggcagaagatc
atacaggtgcacacgctcgttatttctccacaggacgatatgtacacatggctcaagtat
gcgagtctttgtcggaaaagtggaaaccttgcgttgtgtcacaagacactggttatgctg
ctaggagtcgacccatccacagcgagacccgaccaagctcttcccattcaacatccacag
gtaacattcgcttactgcaagcacatgtgggtggatggcaagcgtgacgcagcttatggt
caactccagcgcttcgtgcgtaccttcctaccaggccagcaacaacagcagcagcaacca
gccgaagacgaacgtcaactcgaagctcgcaagcgcctactcgctcgttgttatctcaaa
ctcggagagtggctggaagctctgcaaggtatcaacgaggactcgattcccaatgtcttg
tcttactacgcgcacgcgacaaagcacgatccgagttggtacaaagcctggcacgcgttc
gcctacaccaacttcgaagcggtattgttctataaacaccaacaaacggaaacggcattc
aacgagcagcaacagcaacaacaaaatggaggtccaaacggagcgaatgttttggcaaac
ggagctgcaaagagtcaattgtcgtcccagtttataacgaggttcacggtaccagcgctg
gaaggtttcatcagatcgatcaatctgtcaaatgggaactctctgcaggatacgctcagg
ttgctgacgttgtggttcgagtatggacagtggcctgaagtttacgaggctattatagag
ggcattcgactcattgaaatcaacacttggctacaggttataccgcagctcatagccaga
attgacacaccgcgagctttggtcggacgttgcattcataatcttctcgttgacatcggc
aagactcatcctcaggctctggtatatccattgaccgtggcatcgaagagtgcgagtcac
gcgcgtaagacggccgctaacaagatcttgaacagcatgagcgagcatagtccgacattg
gtacaacaggcgaagatggtgagtgacgagctcatccgcgtagccatactctggcacgag
ttgtggcacgagggtctcgaggaagcgagtagactgtatttcggtgaacgaaatgtcaaa
ggcatgtttgacacactagaacctttacacgcgatgctggagcgcggacctcagacgctc
aaagaaacgtctttcaatcaagcctatggtcgcgacttaatggaagcacaagactggtgt
cacaggtacaaggtgtcaggaaacgtacgcgatctcaatcaagcctgggacctttactac
cacgtgttccggcgaatatcgagacaattaccacagctgacgagtctcgaattgcagtac
gtcagtcctaagctgctgttgtgcagagatttggaactggctgtaccgggaagctatcaa
cccgggcagcctgttatcaggatcggtagtataaatagttcgctgcaagtcataacgagc
aaacagcgaccgagaaagttatgcgtcaagggtagtaacggaaaggattacatgttcttg
ctcaaaggtcacgaagatcttcgtcaggacgagcgtgttatgcagctattcggtctagtc
aatactttgttgctgcacgatccagatacgtttaggagaaatttgacgattcagagatac
gccgttattcctttatctacaaatagtggccttattggatgggtacctcactgtgatact
ttgcacactttaatcagggattaccgagagaaaaagaagatacttctcaacatcgaacat
agaattatgctgagaatggcaccggactacgatcacctgatgctcatgcaaaaagtcgaa
gtttttgaacacgccttagaacacacgtgcggtgacgatttggcccgtttgctctggttg
aaatcaccatcgagcgaggtctggtttgatcgacgcaccaactacactcgctcactggcc
gttatgtcgatggttggatacatcctcggtttgggcgatcgacatccctcgaatcttatg
ttggacaggcttagcggcaaaatacttcacattgactttggcgattgcttcgaggtcgct
atgactcgcgagaagttccctgaaaagatacccttccgtctcacccgaatgttaattaac
gcgatggaggtgacgggtatagagggcacatacagacgcacctgcgaatcggttatgtcg
gtgctacatcgcaacaaggacagcttgatggccgtactcgaggccttcgtttacgatcct
ttgttgaactggaggctgatggacaacgccgctcctaagggcaagaggagcgacgcacag
ggcatgagcactagtagtagtcaggaacatggtgacatgctggattcgttgacagctacg
ttcccgaagaagggcgtaccttgtagcattgaaaacggaggtgacagtaatcagccagaa
gctttgaacaaaaaggctcttcagatcataaacagagtccgtgataagctcactggccgc
gacttttcacacgaagagacgctaagtgtgcagcgacaagtggatcttttgatacaacaa
gcaactaataatgaaaacctctgtcaatgttatataggatggtgtccattttggtaa

DBGET integrated database retrieval system