KEGG   Nasonia vitripennis (jewel wasp): 100118424Help
Entry
100118424         CDS       T01081                                 

Definition
D-aspartate oxidase-like
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:nvi00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:nvi00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:nvi00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis
Cellular Processes; Transport and catabolism; Peroxisome [PATH:nvi04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
2
AA seq 400 aa AA seqDB search
MLNGGMGVVEISAEQLIEFCAQTQADVFATSVGCGSHKCCAKNSTTDCNSYKQKLILKMR
IAVVGAGVIGITTAVAMKEAFPSAELTVFSEAFSPETTGDGSAGLWTPYIIANTDEQKIL
RWSQATHKWLEIFWKSEMASDVGVSLLPSYRLTSSSEGLPVPVWGDVVYGCSKLNKKQLE
RLSKTNEKNYTAGYHYITYTCEPTKMLPFLMKKLRSMNVRIVKTKIKDLKKLKEQGFDVV
INCSGIGSRELCFDKSVIPIRGQVTRVKAPWMFETFLEEDDEGNYVIPNMESVVLGGTHQ
ENDFSVSVCPNDLKFILNGCKRLYPSLDNAEVLKKWVGLRPGRDEVRLELEIVRTEAGQD
LTIVHNYGHGGCGITLSWGCAMDVVEMLRQHLKTKNSSKL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgctaaacggtggtatgggagtagtagagatctccgcagagcagctcatcgagttctgt
gcgcagacacaggcagatgttttcgcaacaagcgttggctgcggttctcacaagtgctgc
gcaaaaaattccacgacggattgtaacagttataaacaaaaactaattttgaaaatgcga
atagcagtggtgggagctggtgttatcggaatcaccacggctgtggcgatgaaggaagct
tttccatccgcagaactgacagttttttcggaggctttttcgccagagacgacaggcgat
ggcagcgccggtttatggaccccctacattatcgccaatacggacgagcaaaaaatactg
cgatggtcacaggcaacgcacaaatggttggaaatcttttggaaaagtgagatggcttct
gacgttggagtttctttgttaccaagttatcgtcttacgtcgagctctgaggggcttcca
gtgccggtttggggcgacgttgtctacggttgttctaagctaaacaagaaacagttggag
cgattgagcaagacaaatgagaagaattatactgctggttatcactacataacgtacact
tgcgagccaacaaaaatgttgccatttttaatgaaaaaattgagatcgatgaacgtgagg
atagtgaaaacaaaaatcaaggatttaaaaaaattaaaggaacagggattcgatgtggta
attaattgcagtggtatcggctcacgtgagctatgtttcgataaatccgttattccaatt
cgaggccaagtaacaagagtgaaagcaccttggatgtttgagacttttttggaggaagac
gacgaaggaaattatgtcattccaaatatggaatcagtggttttaggcggtacgcatcaa
gaaaatgacttcagtgtatctgtgtgtccaaatgacttgaaatttattctgaacggatgc
aaacgcttgtatccatcactagacaatgctgaagttttgaaaaagtgggtcgggcttcgc
ccaggaagagacgaagttcgtttagaactagaaattgttcgcactgaagcaggacaagac
ttgacgattgttcataattatggacatggaggatgcgggataacgctcagctggggctgc
gctatggatgtcgtagaaatgctgcgccagcatctgaagacaaagaactcatcaaaactg
tga

DBGET integrated database retrieval system