KEGG   Nasonia vitripennis (jewel wasp): 100118424Help
Entry
100118424         CDS       T01081                                 

Definition
D-aspartate oxidase-like
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100118424
   00330 Arginine and proline metabolism
    100118424
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    100118424
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    100118424
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100118424
Enzymes [BR:nvi01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     100118424
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
2
AA seq 400 aa AA seqDB search
MLNGGMGVVEISAEQLIEFCAQTQADVFATSVGCGSHKCCAKNSTTDCNSYKQKLILKMR
IAVVGAGVIGITTAVAMKEAFPSAELTVFSEAFSPETTGDGSAGLWTPYIIANTDEQKIL
RWSQATHKWLEIFWKSEMASDVGVSLLPSYRLTSSSEGLPVPVWGDVVYGCSKLNKKQLE
RLSKTNEKNYTAGYHYITYTCEPTKMLPFLMKKLRSMNVRIVKTKIKDLKKLKEQGFDVV
INCSGIGSRELCFDKSVIPIRGQVTRVKAPWMFETFLEEDDEGNYVIPNMESVVLGGTHQ
ENDFSVSVCPNDLKFILNGCKRLYPSLDNAEVLKKWVGLRPGRDEVRLELEIVRTEAGQD
LTIVHNYGHGGCGITLSWGCAMDVVEMLRQHLKTKNSSKL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgctaaacggtggtatgggagtagtagagatctccgcagagcagctcatcgagttctgt
gcgcagacacaggcagatgttttcgcaacaagcgttggctgcggttctcacaagtgctgc
gcaaaaaattccacgacggattgtaacagttataaacaaaaactaattttgaaaatgcga
atagcagtggtgggagctggtgttatcggaatcaccacggctgtggcgatgaaggaagct
tttccatccgcagaactgacagttttttcggaggctttttcgccagagacgacaggcgat
ggcagcgccggtttatggaccccctacattatcgccaatacggacgagcaaaaaatactg
cgatggtcacaggcaacgcacaaatggttggaaatcttttggaaaagtgagatggcttct
gacgttggagtttctttgttaccaagttatcgtcttacgtcgagctctgaggggcttcca
gtgccggtttggggcgacgttgtctacggttgttctaagctaaacaagaaacagttggag
cgattgagcaagacaaatgagaagaattatactgctggttatcactacataacgtacact
tgcgagccaacaaaaatgttgccatttttaatgaaaaaattgagatcgatgaacgtgagg
atagtgaaaacaaaaatcaaggatttaaaaaaattaaaggaacagggattcgatgtggta
attaattgcagtggtatcggctcacgtgagctatgtttcgataaatccgttattccaatt
cgaggccaagtaacaagagtgaaagcaccttggatgtttgagacttttttggaggaagac
gacgaaggaaattatgtcattccaaatatggaatcagtggttttaggcggtacgcatcaa
gaaaatgacttcagtgtatctgtgtgtccaaatgacttgaaatttattctgaacggatgc
aaacgcttgtatccatcactagacaatgctgaagttttgaaaaagtgggtcgggcttcgc
ccaggaagagacgaagttcgtttagaactagaaattgttcgcactgaagcaggacaagac
ttgacgattgttcataattatggacatggaggatgcgggataacgctcagctggggctgc
gctatggatgtcgtagaaatgctgcgccagcatctgaagacaaagaactcatcaaaactg
tga

DBGET integrated database retrieval system