KEGG   Nasonia vitripennis (jewel wasp): 100118439Help
Entry
100118439         CDS       T01081                                 

Definition
protein disulfide-isomerase TMX3
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100118439
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
5
AA seq 429 aa AA seqDB search
MVSLTRILLFATYCVIVNSTAASRVLELSDRFLDIHKEGQWLVMMYAPWCAHCKRLEPIW
AHVAQYLHSSSIRVGRIDCTRFTSVAHSFKIKGFPTILFLKGDQQFVYNGDRTRDEIVKF
ATRLSGPPVQEVTRTTSFNTLKKDRDLYFLYVGEKSGTLWDSYNNIATVFQPHAFFYHSH
PVVVEKHAPIEKTPALFVYKENLHYNFTDHHTITDKDKLNETLYKWVNAERFPTFPKVTR
GNIHQLYLTNKNLVLAVVEENQLEEVPPDMLEFKEMVESVIKKKRQKYHDHFQFGWITNH
DLVNSIAMMVVPLPSLIVINSTTSHHYIPDDEPEKLTPHVIELFLENIQNESAPKYGGNS
WIVRIYRSWFEVRSALASMWKGNPVLTIVLFGLPAIFLLMICYHIWCPDIFDADEEEEET
KGSSHIKKD
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggtttcattgaccagaattctactttttgctacgtactgcgtgatcgtcaacagcact
gcagcctcacgagttctggaactcagtgacaggttcttagatattcataaagaaggacaa
tggcttgttatgatgtatgcaccatggtgtgcacattgcaaaagattagaaccaatttgg
gctcatgtagctcaatatctccattcatcctctatcagagttggccgaatagattgcact
agatttacaagtgtagctcattcgttcaaaatcaaaggatttccaacaatactattctta
aagggagatcaacagtttgtttataatggtgatcgaacaagagatgaaattgttaaattt
gctacaagactgagtgggccaccagttcaagaagtaactaggacaacaagttttaataca
ttaaaaaaagatagagacttgtattttttgtatgtcggagagaaatctggaacgttatgg
gattcatacaacaatatagctactgtattccagcctcatgcatttttttatcactcgcat
ccagttgttgtagaaaaacatgctccgattgaaaagactcctgcactttttgtatataaa
gaaaacctgcactataattttacagatcaccacacaataactgacaaagacaaattaaat
gaaactttgtataaatgggttaatgctgagcgttttccaacattccctaaagtaactcgt
ggaaatattcatcaactgtatttgacaaataaaaatctagtccttgcggtagtagaagaa
aaccaattggaagaagttccaccagacatgttggaattcaaagagatggttgaatctgtg
attaaaaagaaaagacaaaaatatcacgatcatttccaatttggctggataaccaaccat
gacctagtcaatagtatagcaatgatggttgtgccactaccaagtttaattgtaatcaat
tccacgaccagtcatcactatattccagatgatgagccagaaaaactgactccacatgtg
attgaactgtttttagaaaatattcagaatgaaagtgcaccgaaatatggcggaaacagt
tggatagtgagaatatacagatcatggtttgaagtcagatctgctctcgcatcaatgtgg
aaaggcaatccagttttaacaatagtcttgtttggtcttcctgctatatttttattgatg
atctgttatcatatatggtgtccagacatatttgatgcagatgaagaggaagaagaaact
aaaggatcaagtcatataaagaaagactaa

DBGET integrated database retrieval system