KEGG   Nasonia vitripennis (jewel wasp): 100118460Help
Entry
100118460         CDS       T01081                                 

Definition
aromatic-L-amino-acid decarboxylase-like
Orthology
K01593  
aromatic-L-amino-acid decarboxylase [EC:4.1.1.28]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    100118460
   00350 Tyrosine metabolism
    100118460
   00360 Phenylalanine metabolism
    100118460
   00380 Tryptophan metabolism
    100118460
Enzymes [BR:nvi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     100118460
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100118460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
2
AA seq 572 aa AA seqDB search
MNIEEFRIHGKEMVDYICDYIRTLEGKRVTANVDPGYLRPLIPNEAPIKPESFDAIMRDV
ECKIMPGITHWQHPRFHAYFPSGNSFPSILGDMLSDAIGCIGFSWAASPACTELETIVLD
WYAKAIALPTDFLSDSSLNNSESSLSGGGVIQGSASECVLVTMLAARSQAIRSMKEQDPW
TEDSAFLPRLVAYCSTESHSCVEKAAMISLVKLRILEPDDKCCLRGEILETAISEDLAHG
LVPFYVATSLGSTGCCAFDNLLEIGPICKKFPGTWLHVDGAYAGNAFICPEMRHLMSGIE
YADSFNTNPNKWLLVNFDCSCLWVRDRLQLTSALAVDPLYLQHANSAESIDYRHWGIPLS
RRFRALKLWFVMRCYGISGLQNYIRNHIRLAQRFEAKLLNDLRFELLNKVHAGLVCFRLR
GSDELNQELLANINASGRLHMIPARVRGKYTLRFCVVHEHASEEQIDLAFKTILEQVAEL
LSSPRETQPLEQHLSVGKSPKSPTPLDKKLVRKFSFTRSVTRDAYKRSRSKTSLHDGATP
ITVLEESSRPRTSPTHSVVDTIDEDGVFCDER
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgaacattgaggaatttcgcattcatggaaaagaaatggttgattacatttgtgattac
atacgcaccctagaaggaaagcgtgtaaccgcaaacgtggatccgggttatcttaggcct
ctaatacctaacgaagcacccataaagccagaatcttttgacgccattatgagagatgtt
gaatgcaaaataatgcctgggataactcactggcaacatccgcgcttccacgcttatttt
ccttcaggaaactcatttccttcaattcttggagatatgctgtcggatgcaattggctgc
attggtttttcttgggcagcctcgcctgcctgcacggaactcgaaacaattgttttggat
tggtatgcaaaagctattgcattaccaacagattttctatctgatagtagtctcaacaac
tctgaatccagtctgagcggtggaggtgtgattcaaggttctgcctccgaatgcgtcctt
gttacgatgctagctgcacgaagtcaagcgattcggagtatgaaggaacaagatccatgg
accgaagattcagcattcttacctcggcttgttgcttattgttcgacggaatcacattca
tgcgttgaaaaagctgcaatgattagcctggtaaaattacgcattcttgagccggatgac
aaatgttgtctgcgtggtgagattcttgagactgcaattagcgaggatcttgctcacgga
cttgtccctttttatgtggccacaagtctcggatcaactggatgctgtgcatttgacaac
cttcttgaaatcggacccatttgtaagaagtttcctggtacatggcttcacgtcgacgga
gcctatgctggcaatgcattcatttgtccagaaatgcgacacttaatgtcaggcatcgag
tatgctgattcatttaatacgaatccaaacaagtggcttctcgttaatttcgattgttct
tgtctatgggtacgtgaccgtctacaattgacctcagccctagcagttgatcctctttac
ctgcagcatgctaactcggctgaatcgatagattaccgtcattggggtatacctcttagt
cgacgattccgcgcccttaagttatggtttgttatgcgttgctatggaattagtggtcta
caaaattatattcgcaatcatatcagactagcgcaacgttttgaagcaaaactactaaac
gatctacgttttgaattactaaataaagtgcatgctggtttagtttgttttcgactacgt
ggaagtgatgagctcaatcaagagctgcttgcaaatattaatgcatctggcagattacat
atgatacctgctcgagttcgcggaaagtatactttacgcttctgtgttgttcatgagcat
gcaagtgaagaacaaatagacttagcatttaaaaccatcttagagcaagtagcagagttg
ctttctagcccgcgtgagactcaaccactagagcaacatttatctgttggtaagagtcca
aaaagcccaactccgctggacaaaaagcttgtccgaaaattcagttttacacgcagtgtg
acgcgtgatgcttataaacggtcgcgttcaaaaacaagtttgcacgatggcgcaacgcct
attacagtcttagaagagtcatcgcggccccgcacttcaccaactcattcagttgttgat
accattgacgaagatggagtgttttgtgatgagcggtag

DBGET integrated database retrieval system