KEGG   Nasonia vitripennis (jewel wasp): 100118460Help
Entry
100118460         CDS       T01081                                 

Definition
aromatic-L-amino-acid decarboxylase-like
Orthology
K01593  
aromatic-L-amino-acid decarboxylase [EC:4.1.1.28]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:nvi00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:nvi00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:nvi00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:nvi00380]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
2
AA seq 572 aa AA seqDB search
MNIEEFRIHGKEMVDYICDYIRTLEGKRVTANVDPGYLRPLIPNEAPIKPESFDAIMRDV
ECKIMPGITHWQHPRFHAYFPSGNSFPSILGDMLSDAIGCIGFSWAASPACTELETIVLD
WYAKAIALPTDFLSDSSLNNSESSLSGGGVIQGSASECVLVTMLAARSQAIRSMKEQDPW
TEDSAFLPRLVAYCSTESHSCVEKAAMISLVKLRILEPDDKCCLRGEILETAISEDLAHG
LVPFYVATSLGSTGCCAFDNLLEIGPICKKFPGTWLHVDGAYAGNAFICPEMRHLMSGIE
YADSFNTNPNKWLLVNFDCSCLWVRDRLQLTSALAVDPLYLQHANSAESIDYRHWGIPLS
RRFRALKLWFVMRCYGISGLQNYIRNHIRLAQRFEAKLLNDLRFELLNKVHAGLVCFRLR
GSDELNQELLANINASGRLHMIPARVRGKYTLRFCVVHEHASEEQIDLAFKTILEQVAEL
LSSPRETQPLEQHLSVGKSPKSPTPLDKKLVRKFSFTRSVTRDAYKRSRSKTSLHDGATP
ITVLEESSRPRTSPTHSVVDTIDEDGVFCDER
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgaacattgaggaatttcgcattcatggaaaagaaatggttgattacatttgtgattac
atacgcaccctagaaggaaagcgtgtaaccgcaaacgtggatccgggttatcttaggcct
ctaatacctaacgaagcacccataaagccagaatcttttgacgccattatgagagatgtt
gaatgcaaaataatgcctgggataactcactggcaacatccgcgcttccacgcttatttt
ccttcaggaaactcatttccttcaattcttggagatatgctgtcggatgcaattggctgc
attggtttttcttgggcagcctcgcctgcctgcacggaactcgaaacaattgttttggat
tggtatgcaaaagctattgcattaccaacagattttctatctgatagtagtctcaacaac
tctgaatccagtctgagcggtggaggtgtgattcaaggttctgcctccgaatgcgtcctt
gttacgatgctagctgcacgaagtcaagcgattcggagtatgaaggaacaagatccatgg
accgaagattcagcattcttacctcggcttgttgcttattgttcgacggaatcacattca
tgcgttgaaaaagctgcaatgattagcctggtaaaattacgcattcttgagccggatgac
aaatgttgtctgcgtggtgagattcttgagactgcaattagcgaggatcttgctcacgga
cttgtccctttttatgtggccacaagtctcggatcaactggatgctgtgcatttgacaac
cttcttgaaatcggacccatttgtaagaagtttcctggtacatggcttcacgtcgacgga
gcctatgctggcaatgcattcatttgtccagaaatgcgacacttaatgtcaggcatcgag
tatgctgattcatttaatacgaatccaaacaagtggcttctcgttaatttcgattgttct
tgtctatgggtacgtgaccgtctacaattgacctcagccctagcagttgatcctctttac
ctgcagcatgctaactcggctgaatcgatagattaccgtcattggggtatacctcttagt
cgacgattccgcgcccttaagttatggtttgttatgcgttgctatggaattagtggtcta
caaaattatattcgcaatcatatcagactagcgcaacgttttgaagcaaaactactaaac
gatctacgttttgaattactaaataaagtgcatgctggtttagtttgttttcgactacgt
ggaagtgatgagctcaatcaagagctgcttgcaaatattaatgcatctggcagattacat
atgatacctgctcgagttcgcggaaagtatactttacgcttctgtgttgttcatgagcat
gcaagtgaagaacaaatagacttagcatttaaaaccatcttagagcaagtagcagagttg
ctttctagcccgcgtgagactcaaccactagagcaacatttatctgttggtaagagtcca
aaaagcccaactccgctggacaaaaagcttgtccgaaaattcagttttacacgcagtgtg
acgcgtgatgcttataaacggtcgcgttcaaaaacaagtttgcacgatggcgcaacgcct
attacagtcttagaagagtcatcgcggccccgcacttcaccaactcattcagttgttgat
accattgacgaagatggagtgttttgtgatgagcggtag

DBGET integrated database retrieval system