KEGG   Nasonia vitripennis (jewel wasp): 100118463Help
Entry
100118463         CDS       T01081                                 

Definition
1,4-alpha-glucan-branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100118463
Enzymes [BR:nvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     100118463
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100118463
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
1
AA seq 694 aa AA seqDB search
MGGKWSSMDPMEIPVPDLDKLLDRDPYLKPYEKEIRKRYGLFKDYVDKIESGEKDLNQFS
KSYTKFGIHINEDNSVIAKEWAPGAEQVYLTGDFNNWDRTKHPYKKLEFGKWELQLPQNN
DGSCPIKHLSEVKIIIRDKSGQLIERLSPWATYVTQSKNLDEGTTFKQRIWYPGPQNVYQ
PKHPKPKKPESLRIYESHVGIATQEHRVGTYLEFAKNVIPRIKKQGYNAIQLMAVMEHAY
YASFGYQVTSFFAASSRFGTPDELKELIDIAHQNGLYVLLDIVHSHASKNTLDGLNMFDG
TDACFFHSGSRGQHPLWDSRLFNYGDYEVLRFLLSNLRWYTEEYGFDGYRFDGVTSMLYH
SRGLGQGFSGSYDEYFGLNVDVEGIVYLMLANYLLHHYYPEVITIAEDVSGMPGICRPVS
EGGIGFDFRLGMAIPDKWIKLLKETPDENWNMGDIVWTLTNRRWMEKTVAYAESHDQALV
GDKTIAFWLMDKDMYTHMSVLSSPNPVINRGIALHNIIMLITHALGGEAYLNFIGNEFGH
PEWLDFPRVGNNNSYTYARRQWNLADDELLKYKYMGSWDAAVNSLEEKYGWLHSNPAYVS
WKHEDDKIIAFERAGLVFVFNFHPSKSFADYPVGVDRAGTYKVILSSDDTEYGGENRIDS
KVSHFTKPEPFANRANRMFVYAPCRTAIIYATDC
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgggtggaaagtggtcgagtatggatcctatggaaattccagtgcctgatttagataaa
ctgttggacagggatccttacttgaagccctatgaaaaagaaataagaaaaagatatgga
ctatttaaagactatgtagataagatagagtcaggagagaaggatctgaaccagttttct
aaatcatatacaaaatttggaatacatatcaatgaagataattctgttattgcgaaagaa
tgggcaccaggagctgaacaagtttacttgacaggagacttcaataactgggataggaca
aaacacccatacaaaaagttggagtttggaaaatgggagttacagttaccgcaaaataat
gacgggagttgtcctatcaagcatttatctgaagttaaaatcattattagagataaaagt
ggacagctaattgagaggcttagtccttgggccacatatgtcactcaatctaaaaatctg
gatgagggcacaactttcaaacaaaggatctggtaccctggaccacaaaatgtgtatcaa
cccaagcatccaaagccaaagaaaccagaaagtcttcgcatatatgagagtcatgtggga
attgcaactcaagaacaccgtgtaggcacctatctggaatttgctaaaaatgttatacct
cgtataaaaaaacagggttacaatgcaatccaattaatggcagtaatggaacacgcatat
tatgcttcttttggctaccaggtcacttcgttttttgctgcatcctctcgttttggaact
ccagacgaattgaaagaattaatagatattgcccatcaaaatggtctatatgttttactc
gatattgttcattcccacgcctcgaaaaatacgcttgacggattaaatatgtttgatgga
actgatgcctgcttttttcattcgggaagtagaggtcagcatccactttgggacagtaga
ttatttaattatggagactatgaagtattgaggtttttactttcgaatttgcgatggtac
actgaagaatatggttttgatggttacaggtttgatggcgttacttctatgctctaccat
tctagaggtcttgggcaaggatttagtggatcgtatgatgaatattttgggttgaatgta
gatgttgagggcattgtttatctcatgctggcaaattatttattgcatcattattatcct
gaagttattactatagctgaagatgtcagtggaatgcccggaatttgcaggccagttagt
gaagggggtattggtttcgattttcgattaggaatggctattccagataaatggattaaa
cttttaaaagaaacccctgatgaaaattggaatatgggcgatattgtttggacattgact
aatcgaaggtggatggagaaaacagtagcctatgcagaatcgcatgatcaagctcttgtt
ggcgataaaactatcgccttttggctgatggacaaagatatgtacacccatatgagtgtt
ttaagctcaccaaatccagttataaatcgaggaatagcattgcacaatataataatgctc
ataacgcacgccttagggggcgaagcttaccttaactttataggtaatgagtttggacat
ccagaatggttagattttccacgtgtaggtaataataatagttatacttatgctagaaga
caatggaatctagctgacgatgaactgcttaaatacaaatatatgggaagttgggatgca
gctgtgaattcactagaggagaagtatggatggttacattcaaatccagcttatgtttcc
tggaaacacgaagatgataaaattattgcgtttgaacgagctggattagtttttgtattt
aattttcatccgtcaaagtcgtttgctgattaccctgtgggagtagaccgtgctggaact
tacaaagtaattttaagcagcgatgatacagagtatggtggtgagaatcggatcgattcg
aaagtttcacattttacgaaaccagaaccgtttgctaatagagcaaacagaatgtttgta
tacgcaccgtgtcgtactgccataatttatgcaactgattgttag

DBGET integrated database retrieval system