KEGG   Nasonia vitripennis (jewel wasp): 100118752Help
Entry
100118752         CDS       T01081                                 

Definition
phosphoglycerate mutase 2
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100118752
   01230 Biosynthesis of amino acids
    100118752
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100118752
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100118752
Enzymes [BR:nvi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     100118752
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100118752
  Exosomal proteins of melanoma cells
   100118752
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
4
AA seq 254 aa AA seqDB search
MSKYRIVMVRHGESEWNQQNLFCGWYDANLSEKGKSEAAAAGKALKEAGYTFDVAHTSQL
TRAQVTLATILKEIGQENIPIHKTWRLNERHYGGLTGMNKAETAAKYGEEQVQIWRRSFD
TPPPPMEPDHKYYETIVKDPRYAAEPKPEEFPKFESLKLTIERTLPYWNGTIIPQLKEGK
KIIIAAHGNSLRGIVKHLDQMSNDAIMGLNLPTGIPFVYELDENFKPVVSMKFLGDEETV
KAAIASVAAQGKAK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagtaccggattgtgatggttcgccacggcgagagcgagtggaatcagcagaat
ctcttctgcggatggtacgacgctaatctgtccgagaaaggcaaaagcgaagctgctgca
gcaggtaaagcactgaaagaagctggttacaccttcgatgtcgcccatacctctcagttg
accagagcccaggtgactcttgctacaattctgaaggaaattggacaagagaacatcccg
atccacaagacctggcgtctgaacgagcgtcactatggtggactgactggaatgaacaag
gctgagaccgctgccaagtatggagaggagcaagtacaaatctggagacgatccttcgac
acccctccaccaccaatggagccagaccacaagtattacgaaactattgtcaaagatcca
aggtacgccgctgagcccaagcctgaggagttccccaagtttgaatctctgaagctgacc
attgagaggactctaccatactggaatggtaccatcattcctcaactcaaggaaggaaag
aaaatcatcattgctgctcatggtaacagcttgagaggaattgtcaagcaccttgaccaa
atgagcaatgatgctatcatgggtctgaaccttccaactggtattccatttgtatacgaa
ctggatgagaacttcaagccagttgtttccatgaagttccttggtgacgaggagaccgtg
aaggccgcgatcgcatctgttgctgctcagggcaaagcaaagtga

DBGET integrated database retrieval system