KEGG   Nasonia vitripennis (jewel wasp): 100118816Help
Entry
100118816         CDS       T01081                                 

Definition
general transcription factor IIH subunit 4-like
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:nvi03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:nvi03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
Un
AA seq 428 aa AA seqDB search
MISAISVYRELPEIARHYVMRLLFVEQPVPQAVIASWCSKLHVENHLNVVQVMNELNIWK
EAAIPGGLPGWILNATFRKNLKIVLLGGGAPWTMSKQLEIDSKPRDIAFLDSYALERWEC
VLHYMVGSQQQEGISADAVRILLHAGLMKRDEEDGSPVITQAGFQFLLLDTSAQVWYFIL
QYLDTVEARGLDLVECLTFLFQLNFSTLGKDYSTQGMSDGLLMFLQHLREFGLVYQRKRK
AGRFYPTRLALNIATGQDKPISRDLEKERFVIVETNYRVYAYTNSNLQVALIGLFCELLY
RFPNLVVAILTRDSVRAALKSGITAVQIVGYLNQHAHNKMIDPGPPTLPPTIVDQIKLWE
NERNRFIFSEGVLYSQFHSQIDFEVLRDHAVSLGVMIWQSDRKRTMVVTKTGHDDVKKFW
KRYSKGAN
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgatatcagcaatcagtgtctacagagaactgccagagattgcccgacattatgttatg
aggctcctgtttgtagaacaaccagttccacaggctgtcattgcatcttggtgctcaaaa
ctacatgtagagaatcatttaaacgtggtgcaagttatgaatgagttaaatatttggaag
gaagctgctatacctggtggcttgccaggatggatactcaatgccacgtttaggaaaaat
ttaaaaatagtgcttctgggtggtggtgcgccttggactatgtctaaacaacttgagatt
gacagcaaacctagggatatagcttttttggattcttatgctttggaaaggtgggagtgc
gttttgcattatatggttggatcgcaacaacaagaaggcatatcagccgatgctgtcaga
attttattacatgctggccttatgaaaagggatgaagaagatggtagtcctgttataaca
caagcgggttttcaatttttattattagatacttctgctcaggtttggtactttatcctt
caatatttggatacagtggaggcaagaggtttggatttagttgaatgcctgacttttctt
tttcaattgaatttttccacacttggaaaagattacagtacacaaggtatgtcagatggc
cttttgatgtttctacaacatctgagagaatttggccttgtatatcaacgaaaaagaaaa
gcaggaagattttatccaacacgactagctttgaatattgcaacaggacaagacaaacct
atctcaagagatttggaaaaagaacgctttgtcatagttgaaacaaattatagggtatat
gcatacacaaactcaaatctgcaagttgcactcattggtttattttgtgaattactctac
agatttccaaatttagtggttgcaatattgacaagagattctgtacgagcagccttaaaa
agtggtatcactgctgtacaaatagtaggatatctgaatcagcatgctcataataaaatg
attgatcctggaccaccaactcttccaccaactattgtagatcagattaaactatgggaa
aatgaaagaaatcgctttatattcagcgaaggagttctttatagtcaatttcattctcaa
attgattttgaagttcttagagatcatgctgtatctttgggtgtaatgatttggcaaagt
gacaggaaacgaactatggttgttacaaaaacaggtcatgatgatgtcaaaaaattctgg
aagcgatattcaaaaggagccaattaa

DBGET integrated database retrieval system