KEGG   Nasonia vitripennis (jewel wasp): 100118816Help
Entry
100118816         CDS       T01081                                 

Definition
general transcription factor IIH subunit 4
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    100118816
  Replication and repair
   03420 Nucleotide excision repair
    100118816
Transcription machinery [BR:nvi03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100118816
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
Un
AA seq 428 aa AA seqDB search
MISAISVYRELPEIARHYVMRLLFVEQPVPQAVIASWCSKLHVENHLNVVQVMNELNIWK
EAAIPGGLPGWILNATFRKNLKIVLLGGGAPWTMSKQLEIDSKPRDIAFLDSYALERWEC
VLHYMVGSQQQEGISADAVRILLHAGLMKRDEEDGSPVITQAGFQFLLLDTSAQVWYFIL
QYLDTVEARGLDLVECLTFLFQLNFSTLGKDYSTQGMSDGLLMFLQHLREFGLVYQRKRK
AGRFYPTRLALNIATGQDKPISRDLEKERFVIVETNYRVYAYTNSNLQVALIGLFCELLY
RFPNLVVAILTRDSVRAALKSGITAVQIVGYLNQHAHNKMIDPGPPTLPPTIVDQIKLWE
NERNRFIFSEGVLYSQFHSQIDFEVLRDHAVSLGVMIWQSDRKRTMVVTKTGHDDVKKFW
KRYSKGAN
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgatatcagcaatcagtgtctacagagaactgccagagattgcccgacattatgttatg
aggctcctgtttgtagaacaaccagttccacaggctgtcattgcatcttggtgctcaaaa
ctacatgtagagaatcatttaaacgtggtgcaagttatgaatgagttaaatatttggaag
gaagctgctatacctggtggcttgccaggatggatactcaatgccacgtttaggaaaaat
ttaaaaatagtgcttctgggtggtggtgcgccttggactatgtctaaacaacttgagatt
gacagcaaacctagggatatagcttttttggattcttatgctttggaaaggtgggagtgc
gttttgcattatatggttggatcgcaacaacaagaaggcatatcagccgatgctgtcaga
attttattacatgctggccttatgaaaagggatgaagaagatggtagtcctgttataaca
caagcgggttttcaatttttattattagatacttctgctcaggtttggtactttatcctt
caatatttggatacagtggaggcaagaggtttggatttagttgaatgcctgacttttctt
tttcaattgaatttttccacacttggaaaagattacagtacacaaggtatgtcagatggc
cttttgatgtttctacaacatctgagagaatttggccttgtatatcaacgaaaaagaaaa
gcaggaagattttatccaacacgactagctttgaatattgcaacaggacaagacaaacct
atctcaagagatttggaaaaagaacgctttgtcatagttgaaacaaattatagggtatat
gcatacacaaactcaaatctgcaagttgcactcattggtttattttgtgaattactctac
agatttccaaatttagtggttgcaatattgacaagagattctgtacgagcagccttaaaa
agtggtatcactgctgtacaaatagtaggatatctgaatcagcatgctcataataaaatg
attgatcctggaccaccaactcttccaccaactattgtagatcagattaaactatgggaa
aatgaaagaaatcgctttatattcagcgaaggagttctttatagtcaatttcattctcaa
attgattttgaagttcttagagatcatgctgtatctttgggtgtaatgatttggcaaagt
gacaggaaacgaactatggttgttacaaaaacaggtcatgatgatgtcaaaaaattctgg
aagcgatattcaaaaggagccaattaa

DBGET integrated database retrieval system