KEGG   Nasonia vitripennis (jewel wasp): 100118820Help
Entry
100118820         CDS       T01081                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L3-like
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
1
AA seq 226 aa AA seqDB search
MAWVPLESNPEVMTKFIHKLGVPTKWELMDVYGLDPELLAVLPKPVVALILLYPISPKTE
DFKNELEKKEKDSGANNNKVYHLIQYVSNACGTVALIHSVANNLNRIELEDGVLKKFLEE
TKDLTSQQRGEKLMEAQGISSTHEDFAQEGQTEAPSEDEKVIHHFVAFVERDGSIYELDG
RKPYPINHGSSNSETFLEDAARICREYMNREPGEVRFTMMALAAAE
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcttgggttccacttgaatcgaatcccgaggttatgaccaagttcatacataagctt
ggtgtgcctacaaaatgggaactgatggatgtgtacggtctggatccagagcttttggcg
gtgctgccaaagccagttgtagccctcatattgctctatcctatttcaccaaagacagaa
gactttaaaaatgagttagagaagaaagaaaaggacagtggtgctaataacaataaagtt
tatcatttaattcagtatgtatcgaatgcttgtggaacagtggcattaattcatagtgtg
gccaataatctcaatcgaattgaacttgaagatggagtactgaagaaatttttggaagaa
accaaagacttaacttctcaacaaaggggtgaaaaactgatggaggctcaaggtattagc
agtacccatgaggactttgcgcaagaaggacaaactgaggcaccaagtgaagatgagaaa
gtcatccatcattttgtggcatttgttgaaagggatggatcgatatatgaacttgatggt
agaaagccatatcccatcaatcacggatcatctaattctgagacgttcctcgaagatgcc
gctcgcatatgccgagaatacatgaatcgtgaaccaggagaagtccgctttaccatgatg
gcattagcagcagctgaataa

DBGET integrated database retrieval system