KEGG   Nasonia vitripennis (jewel wasp): 100118860Help
Entry
100118860         CDS       T01081                                 

Definition
aldose 1-epimerase-like
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100118860
   00052 Galactose metabolism
    100118860
Enzymes [BR:nvi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     100118860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
1
AA seq 355 aa AA seqDB search
MGSTSIQVQPWGTVAGKEVKKFTIKNSKNQEVDIISYGATIMAIRTPDKVGKIDDVVCGF
DNIEGYLSSINPYFGATVGRVANRIAGGRFTIDNVQYQVSKNIGNDTLHGGFKGWSFKVW
EATIEKDSVVMALLSQDGDEGFPGAVLASITFKLTDDGKLQIEMQSTTAKATPVNLTNHS
YFNLAGHGTNAAEIYKHQVTMNADRWIVTDAESIPTGEIRSVDKSIFDLRKPTILGDVIN
QVLGGGYDYNFCLPECTDLSKENFVAKVIHPGSGRTLEVFSNQPGVQFYTANGFPESGTE
GIPGKQGKKYFKHGAFCLETQNYPDAVNHKNFPDSILRPHHVYYHVVTYKFGVQS
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgggttcaactagtatacaagtacagccatggggtactgtagctggaaaggaagtaaaa
aagtttaccataaaaaattctaaaaatcaagaggttgacattatttcttacggagcaacc
atcatggcaatacgaactccagacaaagttggaaaaattgacgatgttgtttgtggcttt
gataacattgaaggatatttatcgtcaatcaatccatattttggagcaaccgttggcaga
gttgcaaatcgtatagcaggaggccgatttacaattgataatgtacagtatcaggtttca
aagaacataggtaatgatactctacatggagggtttaaaggctggagttttaaagtctgg
gaagccacaatcgagaaggattctgttgtaatggccctgcttagccaagacggcgatgaa
ggatttcctggtgccgtgcttgcctctataacgtttaaacttaccgatgatggcaaactg
caaattgagatgcaatctacaactgctaaagctacacctgtcaatttgacgaatcacagc
tacttcaacctagctggacatggaacaaatgctgctgaaatttacaagcatcaagtcacc
atgaatgcagatcgatggatagttacagatgcagaaagtatcccaactggagaaatacgt
tctgttgataagagcatatttgacttaagaaagccaacaattcttggtgatgtgattaac
caagtactgggtggtggatatgattacaacttttgtttacccgaatgtactgatttatct
aaagagaactttgttgctaaagtaattcatcctggttctggtagaacattggaagtcttt
agtaatcaacccggagttcagttttacactgcaaacggctttcctgaaagtggtactgaa
ggtattccaggaaagcaaggaaagaaatattttaaacatggagcattttgtctggaaaca
caaaattatccagatgctgtaaatcataaaaatttcccagacagcattttgcgaccacat
catgtatattatcatgttgtcacatataaatttggtgtacaatcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system