KEGG   Nasonia vitripennis (jewel wasp): 100118925Help
Entry
100118925         CDS       T01081                                 

Definition
uncharacterized LOC100118925
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
4
AA seq 881 aa AA seqDB search
MTPKRKTTSSESTSSSSSGSSSSSSSSSGSESSSSDSENSSSSAASQKASDSDRVKKKVP
LAAARHVKSKNETNPPPVEAKGKEKAAPKSRPVVYSSESEEPPVKGKQPPAKRKPPAKPK
ATATVAPVVKQQKPASKPTPPVAQHKNTLSSKPVNKVNKFPASITSSAKSGDKNAKSSSE
PAQKKLKKKSIFSPENSSESDSGVPVKPPSKKVVSNSVNAAQSQPQQAKVKPTEQKSRPP
VANRPSLVTKQPVKSESSASSKSSGGSGGSGSSSSDSSSESESSESEASPQPQPKKKEPQ
STSRPAPIVNTPTKRAATSIATVKPQKSIKRQNTIKSEDDSENADSDKDMEDNAEEEQSK
PAAKGKRKLQARKGKTQPPPIKTLASDSESDAADSKRSISKSPSKRPAQSLSSRQLGLSR
SASGSIPTKGQSSSSRMRSVKERECPLAPACDSRGHLSGRFDVHFTLEACPMYHNTSPQG
CIEFYKERKKRDDERKRVIISMGKKSPKGGYQTNEQRNYQLKIKELRSKFKGALADGNES
DSRGETQGIDKNRQPTLVGLTSDYDLKLFLEAQAAASEKIEKDLKELEFEGEGRNGGIGT
RCVEMGKWEMEVWYQSPYPEEYSRAPKLYLCEYCLKYAKSRQVLRRHREKCVWRHPPGHE
VYRKEKIGVWEVDGRRYKLYCQNLCLLAKFFLDHKTLYYDVEPFLFYVMTINDSEGCHTV
GYFSKEKSSNNNYNVSCILTLPPYQRQGYGRLLIDFSYLLTRVENKIGSPEKPLSDLGLI
SYRSYWKDVLLQYLCNFGGKEISVKDISKEMAIDSSDIVSTLQALGMMKYWKGKHIILKK
QDVIDDYKERVKRRGTVYKEIDPECLKWSPFQPPKTPSASS
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgactccaaaacgaaaaaccacgagctcggagtcgacatcctcaagcagctctggctcc
tcatccagcagttcttccagctcaggaagtgaatccagttcctctgattctgaaaattcg
agtagttcagcagccagtcaaaaagcatcagactctgatcgggtaaaaaagaaagtacct
ttagctgctgctcgccatgtcaaatctaaaaatgaaacaaacccaccacctgtggaagct
aaaggcaaggagaaagctgcaccaaaatctaggcctgttgtgtactcctctgagtctgaa
gaacctccggtgaaaggtaagcagccaccagcgaagcggaaaccaccagcaaagccaaaa
gctactgctacagttgctccagttgtaaaacaacaaaagcctgctagtaagccaactcct
cctgttgcgcagcacaaaaatactttgtcatcgaagccagtcaacaaagtgaacaaattt
cctgctagtataacatcttcagctaaatcaggagataaaaatgccaaatctagctctgaa
ccagcgcagaaaaaattaaagaaaaaaagtatttttagtcctgaaaatagtagtgaaagt
gacagtggtgtacctgtaaaaccacctagcaagaaagttgtgagtaattcagtgaatgct
gcgcaatctcagcctcaacaagctaaagtaaagccaactgaacaaaaatctcgtcctcca
gttgccaatagacctagtttagtgaccaaacaaccagtaaaatctgagagttctgcaagt
tctaaaagttcaggtggatctggtggttctggttcatcatcgtcagatagtagttcagaa
tcggagtcttcagaaagtgaagcaagtcctcaacctcaaccaaaaaagaaagaacctcaa
tctacctccagacctgcaccaattgtaaacactcctacaaagagagcggccacttcaata
gctacagtaaaacctcaaaaaagtatcaaacgtcaaaatacaatcaaaagcgaagatgac
agtgaaaatgcagactccgataaagatatggaagataatgctgaggaggaacagagtaaa
ccagctgcaaaagggaaacggaaattacaagcgcgtaaaggcaaaactcagccaccccca
attaaaacgcttgcgagtgattctgaatctgatgcagcggatagtaaacgtagtatttca
aaatcgcctagcaaacgacccgcacaaagcctgtcgtccaggcaattgggtctcagtagg
tcggcaagtggaagtattcctactaaaggtcaaagctccagcagtaggatgcgctctgta
aaggagagagaatgcccattagcacctgcctgtgattctcgaggtcatctttcaggaaga
tttgacgttcattttacgttagaagcttgtcccatgtaccataatacctccccacaaggc
tgcatagaattctataaggaacggaaaaagcgagatgacgaacgaaagcgagtgataata
agtatgggaaaaaagtcgcctaaaggtggctaccaaacgaacgagcagcgtaattatcaa
ttaaaaatcaaagaactgagaagtaaattcaaaggagcgcttgcggacggcaacgagtcg
gacagtagaggagaaacgcagggaatcgacaaaaaccgacaaccgacgcttgtgggtctt
acgtcagactatgatctcaaacttttcttagaggctcaagcagctgctagtgaaaaaatt
gaaaaagacttgaaagagctcgaattcgagggcgaaggtagaaacggtggcataggcacc
cgttgcgtagaaatgggtaaatgggagatggaagtctggtaccagagtccatatcccgag
gagtacagccgtgctccaaagctttatttatgtgaatactgtttgaagtatgcgaagagt
cggcaggtattgagaaggcatcgagaaaaatgcgtttggaggcatcctccaggtcacgag
gtttacaggaaggaaaagataggcgtatgggaagtggacgggaggcgatacaaactgtac
tgccaaaacctttgccttttagcaaaattcttcttagatcataagactctctattatgac
gtggagcctttcctcttctacgttatgacaatcaatgattccgaaggctgtcatacagtc
ggttattttagtaaggaaaaaagttccaataacaactacaacgtctcctgcatactcact
ctgccgccgtatcagcggcaaggttacggtcggctgctcatcgacttcagctacttactc
acgagggtcgagaataaaataggctcgccggaaaagccgctgtcggacctcggactaatc
tcctacaggagctactggaaggacgtgctgctgcagtacctctgcaacttcggcggcaag
gagatttccgtgaaagacatcagcaaggagatggccatcgactcgtcggacatcgtgagc
acgctgcaagccttaggaatgatgaagtactggaagggcaagcatatcatacttaagaag
caggacgtgatcgacgactacaaggagcgggtgaagcgccggggtaccgtctacaaggag
atcgatccggagtgcctgaagtggagccctttccagccgcccaagacgccctctgcctcg
agctga

DBGET integrated database retrieval system