KEGG   Nasonia vitripennis (jewel wasp): 100118951Help
Entry
100118951         CDS       T01081                                 

Gene name
Pcmt
Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     100118951 (Pcmt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
3
AA seq 251 aa AA seqDB search
MFQFGRFHGKGNLELVQHLRKSGVIKSERVFDAMSKVDRGKYTEPCDAYIDSPQSIGFGA
TISAPHMHGYALEFLADKLKDGSRALDVGSGSGYLTACMALMVGPKGVAVGIEHVPKLQE
RARRNIQSDHPELLESKQLELIVGDGRLGYPNKAPYDAIHIGAAAPEAPEILINQLAPGG
RMIVPIGKTNADQTLFQIDKTMDGKIQKTSLMGVVYVPLCDKSRQGYFIRVLNFQIITKI
YKNNILCSIPN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaattcggccgttttcacggtaaaggaaatttagaattagttcaacatcttaga
aaatctggagtaatcaaatcagaaagagtgtttgacgcaatgagtaaagtggacagagga
aaatacacagaaccttgtgatgcatatatcgattcacctcaaagcatcggatttggtgca
acaattagtgcaccacatatgcatggctatgcactggaatttctcgcagataaattaaaa
gatggcagtagagcattagatgttggatctggttctggctatttaactgcatgtatggca
ctgatggttggtcctaaaggtgttgccgtgggtattgagcatgtgccgaaacttcaagaa
cgagctagaagaaatattcaaagtgatcatcctgaattattggaaagcaaacaacttgaa
ttgatagttggtgatggtagactgggttacccaaataaagcaccatacgatgctattcac
attggagcagcagctccggaagcaccagaaatacttattaatcagctagctcctggtggc
cgtatgatcgtaccaattggaaagacgaacgctgaccaaaccttgtttcaaatagataaa
actatggatggcaaaattcagaagacatcattaatgggagttgtctatgtcccgttatgt
gataagagtcgacaaggttattttatcagagtgctaaattttcagattattacaaaaata
tataaaaacaatattttgtgttcaattcctaattag

DBGET integrated database retrieval system