KEGG   Nasonia vitripennis (jewel wasp): 100119020Help
Entry
100119020         CDS       T01081                                 

Definition
aldehyde dehydrogenase family 1 member L1-like
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
One carbon pool by folate
Class
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:nvi00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
1
AA seq 902 aa AA seqDB search
MRKLKVAIIGQSNFAAEVYKSLKRDGHEVTGVFTIPDKVNREDPLAITAKADGTPVFKIK
AWRSKGLPLPEVLDLYKSIEVDLNVLPFCTQFIPMEVINHPKHRSICYHPSILPRHRGAS
AISWTLIEGDEVAGFSVFWADDGLDTGPILLQRSCPVKPNDTLDSLYNGFMYPEGIKAMA
EAVNLVAKGTAPCVPQTEEGATYDAMLNKKELQRLDWKGKSAKQAHDFIRALDSTPGAWT
LIDGEEARLYGSSLWKGNETIPSGTAVDIDGRPAVVHETGLLMQAEDGNWLNVEVLKIGT
RTISASKYGQAQSNGTCLEFTEEERQAVETIRKIWQSILRRDIDDDTDFFACGAGSMDVV
RLVEEMKDSLDIHLQNTDVFMAPVFMELVNSAILAKRGASASQNIAYEAVVLQANNMDLS
FPRQLFVNGKFVNGRGKPIVSVNPHDESVICSVESASIEDVDEAVKAAKKAFEEGEWSKI
SARERGALLFKLADLMEQHKEELATLESLDSGAVYTLALKTHVGMSIETWRYFAGWCDKI
QGATVPISHARPNRNLTMTRKEPIGVCGLVTPWNYPLMMLSWKMAACLAAGNTVVMKPAQ
TSALTALKFAELSAKAGIPPGVINIVPGSGSITGNAIVNHHLVRKLGFTGSTEIGQMIMR
SCADSNLKKVSLELGGKSPLVIFEDADMQQAVRLAMSSVFFNKGENCIAAGRIFVEERIL
DEFLDRVVAETKKIAIGDPLNRGTSHGPQNHKAHLDKLLEFVEKGVKEGARLVYGGRRLD
RPGFYFEPTIFADVRDGGFLATEESFGPIMIVSSFSSNDLDKVIARANATEYGLASGVLT
KDISRALRFAEKIDAGTVFVNTYNKTDVAAPFGGFKRSGFGKDLGQEALNEYLKTKTITI
EY
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagttaaaggttgccattatcggccaaagcaacttcgcggctgaggtctacaag
tcattgaaaagggacggacacgaggtcaccggagttttcacgataccggacaaggtcaat
cgcgaggatccactggcgataacagcgaaggccgatggcactccggtcttcaagatcaag
gcctggcgcagcaagggtctacctctgccggaggtcctcgacctctacaagagcatcgag
gtcgacctgaacgtgttgcccttttgcacccaattcatacccatggaagtgatcaaccat
cccaagcatcggagcatctgctaccatccgtcgattctgccaaggcatcgtggcgcgagt
gccatcagctggactctgatcgaaggcgacgaggtggccggtttctcggtcttctgggct
gacgacggcctggacaccggaccgatcctcctccaacgcagctgtcccgtgaagcccaac
gatactctggacagtctgtacaacgggttcatgtacccggagggtatcaaggcgatggcc
gaggcagtgaacctcgtggctaagggtacagcgccgtgcgtacctcagaccgaggaaggc
gcgacctacgacgctatgctgaacaaaaaggaactgcagaggctcgactggaagggaaaa
agtgccaagcaggcgcacgattttatcagggctttggactcgacaccaggtgcttggacg
cttatcgacggcgaggaggcgaggttgtacggcagcagtttgtggaaaggaaacgagaca
ataccctcgggaacagcagtggacatcgacggccggccagctgtggttcacgagacgggt
ctgctgatgcaggcagaggacggaaactggctgaacgtcgaggttctgaaaatcggtacg
cgtacgataagcgcaagcaagtacggccaggctcagagcaacggcacctgtctcgagttc
acggaggaggagcgacaagctgtcgagaccatccgtaaaatctggcaaagcatactgcgc
cgggatatcgacgacgataccgatttcttcgcttgtggtgccggcagcatggacgtcgtc
cgtctggtcgaggagatgaaggacagcctggacattcacttgcagaacaccgacgtgttc
atggcgccggttttcatggaactggtaaactcggcgatactggccaaacgcggagcaagc
gccagccagaacatcgcctacgaggcggtcgtgctccaagcgaacaacatggacctgagc
ttcccgagacagctgttcgtcaacggcaagttcgtcaacggtcgtggaaagccgatcgtc
tcggttaacccgcacgacgagagcgtcatctgctcggtggaaagcgcctcgatcgaggat
gtcgacgaggcggtcaaggcggccaagaaggctttcgaggagggagagtggagcaagatc
agcgcgagagaacgaggcgctctgcttttcaagctagccgacctgatggagcagcacaag
gaggagctagccaccctggagagtctcgactccggcgcggtgtacaccctggccttgaaa
acccacgtgggcatgtcgatcgagacatggcgctacttcgccggctggtgcgacaagatt
caaggggctaccgtaccgatctctcacgcccggccgaatcggaacctgacgatgacgcgg
aaggaaccgatcggagtctgcggccttgtcacgccctggaactacccgctgatgatgctc
tcctggaagatggctgcttgtctggcggctggaaacactgttgtcatgaaacctgctcag
acctcagcactgacggcgctcaagtttgccgagctgtccgccaaggccggcattccacca
ggtgtgataaacatcgttcccggaagcggttcgatcaccgggaacgccatcgtcaatcac
cacctcgtgagaaagctcggattcacaggatcgacggaaatcggccagatgataatgcga
tcgtgcgccgacagtaatctgaagaaagtctcgctcgaactcggcggaaagagtccactg
gtgatattcgaagacgccgacatgcaacaagccgtcagacttgcaatgagcagtgtcttc
ttcaataaaggagagaactgcattgctgccggtcgaatcttcgtggaagagcgcatcctc
gacgagttcctggatcgcgtggtcgccgagacgaagaagatcgcgatcggcgaccccttg
aaccgtggcacctcccacggaccccagaaccacaaggcccacctcgacaaactcctggaa
ttcgtcgagaagggagtgaaggaaggcgcgcgtctggtgtacggtggccgcagactcgac
aggcccggtttctacttcgagcccacgatcttcgccgacgttcgcgacggcggcttccta
gcgaccgaggagtccttcggacccatcatgatcgtctcgagcttcagctccaacgacctg
gacaaggtaatcgccagggctaacgcgaccgagtacggacttgcttctggagttctgacc
aaggacatcagccgagcgttgaggttcgcggagaagatcgacgccggtacggtgttcgtt
aacacttacaataagaccgacgtggctgcgccgtttggagggttcaagaggtctggattc
ggaaaggatctgggacaggaggcgcttaacgagtatctgaagaccaagactatcactatc
gagtactga

DBGET integrated database retrieval system