KEGG   Nasonia vitripennis (jewel wasp): 100119029Help
Entry
100119029         CDS       T01081                                 

Definition
tyramine beta-hydroxylase
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    100119029
Enzymes [BR:nvi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     100119029
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
2
AA seq 580 aa AA seqDB search
MKFSAVLVLVSHILIAVSGRWHQSESTLAVHSVPLGSEASFHWRVELTTEQIVAEVHYAA
EEYSWFAVGFSNYGELKPADYCVLWVDWHRETHLEDASSDADTKLNTDEQQDCTNFEWKK
HGNVTKFTFTRKFDTCDERDYVIERGTTHLVWLKGSGPLTSVAGLQVADAKSSGMSRTEL
LRIHHPKPQFPADAWQHEIRADRVQVPNVETTYWCHVQKLPSSMRRKHHVLQFGPAIQQG
NEHLVHHMEVFHCAGPADVDVPLYNGPCDAPNRPERTQICKKVLAAWAMGADAFVYPEEA
GLPIGGENFNRFVMLEVHYNNPELLAGNVDSSGIRFIFTKSLRKYDAGVIELGLEYTDKM
AIPPGQEAFLLSGHCISECTGVGLPQSGIKIFGSQLHTHLTGRGVVTRHIRNGEELPMLN
YDNHYSTHFQEIRLLPQPVTVLPGDSLITTCTYETLDRENVTLGGFAISDEMCVNYIHYY
PNSKLEVCKSAISDDALRTYFRYMKEWESQRTGGEKGISENYKSIEWTKVRVAALHDLYE
VAPLGMQCNGSDGSRLPGLWDNIAATPVRLPLAPMARGCP
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttccgccgtcctcgttctcgtctcccacatcctcatcgcagtatccggaagg
tggcatcagtcggaatcaactttagccgtacactcggtgcctctgggctccgaagccagt
tttcactggagagttgaactgacgaccgagcagatagtggccgaagtacactacgcagct
gaggaatattcgtggtttgcggtgggcttttcgaactatggagaactgaaaccagcggat
tactgcgttctctgggtggactggcatcgcgagacccaccttgaagatgcttcgagcgat
gctgatactaaattgaatacggacgagcagcaggattgcacgaatttcgagtggaaaaag
cacggcaacgtaaccaagttcaccttcaccaggaaattcgatacttgcgacgagcgcgac
tacgtgatcgagagaggtacaactcacctggtatggctgaagggcagtgggcctctgact
tcggtggcgggtctacaggtagccgatgccaaatcttcggggatgtcgagaacggagttg
ctcaggattcaccacccaaagccgcagttcccggccgatgcttggcagcacgagatcaga
gccgatcgggtacaggtgcccaatgtcgagacgacctactggtgtcacgtgcagaagtta
ccctcctcgatgagacgcaaacatcacgttcttcaatttggaccagctatacaacagggc
aacgaacatctggtacatcacatggaagttttccattgtgctggacccgcagacgtagac
gtgcctctatacaacggaccgtgcgacgcgcctaatcgtccagaacgaactcagatctgt
aagaaagtgctggcagcctgggctatgggtgccgatgctttcgtctatcccgaggaagcg
ggtctgccgatcggcggggaaaactttaatcgttttgtcatgctcgaggtccactataac
aaccctgaacttttagcaggcaacgttgactcgtctggaatacgctttatcttcaccaag
agtctgaggaagtacgatgcaggcgtgattgaactcggtctcgagtatactgataaaatg
gccatccctccaggacaggaagcattcttactctcgggtcactgcatctccgagtgtaca
ggtgtaggtctaccccagagtggcatcaaaatctttggttcgcagttacacacccacttg
acgggccgaggtgtcgtcacgagacatatacggaacggcgaggaactgcccatgcttaac
tatgacaatcattattccacgcatttccaagagatacgactgctgccacaaccagtcact
gttctcccgggtgattcgttgataacgacctgcacgtacgaaacgttggacagggaaaat
gtcactctgggtggttttgctatttcggatgaaatgtgcgtaaactatatccattactat
ccaaattcgaaattagaggtttgtaaaagcgctataagtgatgacgcattgagaacgtat
ttccgctacatgaaagaatgggagagtcaaagaacgggcggcgaaaagggaatctcagaa
aattacaaaagcatcgaatggactaaggtccgcgttgcagctttgcacgatctctatgaa
gtcgctcctttaggaatgcagtgcaatggctcagacgggtctcggctacctggcttatgg
gacaatattgcggcgacgccggttagacttcctcttgcaccgatggctcgtggttgtccg
tag

DBGET integrated database retrieval system