KEGG   Nasonia vitripennis (jewel wasp): 100119143Help
Entry
100119143         CDS       T01081                                 

Definition
histone acetyltransferase KAT2A-like
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100119143
Enzymes [BR:nvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100119143
Transcription machinery [BR:nvi03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100119143
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
1
AA seq 816 aa AA seqDB search
MSGEEGSRPISNVSAESVGQPVTSTSQGTSNNAEGKTTPRPEQDSRQNNLLRIQQRKQQM
FNLPQVKKLLKLANYSACQVDECKCNGWKNTQTVAKSPKNEAQPIATFSDPCRSCDHILE
NHISHLVSQSDEMINKLLGMVVDVDNIFMGMHREEDPDTKRVYYFLFKLLRKSILSMTKP
AIEGPLGQPPFEKPSISKAIANFVVYKFGHLSQRDWQSMYDLAKNFLHCLNHWNFETPSA
RKTAVNADEAPAYKINYTRWLVFCHVPAFCDSLPHFDTTLVFGRTLLQAVFKSVCKQLMD
KCHSEKDRMSAEKRVLVLNHFPKFLSMLEIEIYSENSPIWDPEFKQVLPSHLQMSVESKA
NLNRRTVGEFEKVTVAPNDKDNFTTINLSPGMKKLQGKRSHSEIRPDAKKRKTEEVFEDL
SEETVMKIIATIKDPNYMFGLDAIFPPNAPRDETPKLEESRKIIEFHIVGNSLTQPVSKQ
TMLWLIGLHNVFSHQLTRMPMEYISQLVFDPKHKTLALIKDGRPIGGICFRMFASQGFTE
IVFCAMTSEQQVKGYGTHLMNMLKDYHIKHNILHFLTFADEFAIGYFKKQGFSKDIKLPR
TTFQGYIKDYEGAMLMHCELNAKIVYTEFTTVVRKQKEIVKQLIYQRQQEIQKIHPGLTC
FKEGVRGIPVESIPGIRETGWKNYAQTRTRGVAKGSQGPEPMEACLDINDSLYNALKSVL
TSIKNHSAAWPFLKPVDKSEVPDYYDHIKYPMDLKTMTDRLKSRYYVTRRLFIADMTRIF
TNCRLYNGPDTEYYSCANSLEKYFQTKMKEIGLWDK
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggaagaaggcagcagacctatatccaacgtatctgcggagagtgtggggcaa
cctgtgacaagtacatcacaaggaacaagtaataatgcagaaggaaagactactccacga
ccggaacaggacagcagacaaaataacctgctcaggattcaacagcgcaagcagcaaatg
tttaacttgcctcaagtgaaaaaactgttaaaacttgcaaattacagtgcttgtcaagtc
gatgaatgcaagtgcaatggctggaaaaatacacagacagttgcaaagtctccaaagaat
gaggcacagccaattgcaacattcagtgatccttgtagaagctgtgatcacattttagaa
aatcacatttctcatctggtttcacaatcagatgaaatgataaacaagttattagggatg
gttgttgatgtagataacatattcatgggaatgcacagggaagaggatccagatacaaaa
agagtgtattattttttattcaaacttttaagaaagagtattttgtcgatgacaaagcca
gctatagaaggaccactaggtcagccaccatttgaaaagccaagtatatcaaaggcaatt
gcaaactttgtagtttataagtttggtcatttatcgcaacgtgattggcaatcaatgtac
gacttggcgaaaaattttttgcactgcttaaaccattggaattttgagactcctagtgcc
agaaagacagctgttaatgcagatgaagcgccagcttataagattaattacacaaggtgg
cttgtgttttgtcatgtacctgcattttgcgattcgcttcctcattttgacacaactcta
gtgtttggtagaactttactccaagcagttttcaaatcagtttgtaaacagttgatggac
aaatgccacagtgaaaaggataggatgtcagctgagaaacgagttctcgttttaaaccat
tttccaaaattcctttcaatgttagaaatcgaaatctattcggaaaactctccaatatgg
gatccagaatttaagcaggttcttccatcccacttgcaaatgtcagtagaatccaaagca
aatctgaatcgcagaacagttggagagtttgagaaagtgacagtagcacccaacgataag
gataactttacgacaattaacctcagtccaggcatgaagaagcttcaaggtaaaaggtca
cattcagaaatcaggccagacgcaaagaaaagaaagactgaggaagtttttgaggacttg
tcagaggaaaccgtaatgaagatcatagcaactattaaggatccgaactacatgtttgga
ctggacgctattttcccaccaaacgcacccagagatgagactccaaaattagaggagagc
cgtaaaatcatagagtttcacatagtcggtaatagtttgacacaacctgtctctaaacaa
actatgctgtggctcattggacttcacaacgtgtttagtcatcaactaacaagaatgcct
atggaatacatttcacaattagtttttgatccgaagcacaaaactctagcgctaataaaa
gacggcagacccatcggtggaatctgtttccgaatgttcgcaagccaagggttcaccgaa
attgtattttgcgccatgacgtccgaacagcaagttaaaggctacggcacccatctaatg
aacatgctcaaggattatcacatcaaacataatatacttcatttcctcacgtttgccgat
gaattcgctattggctattttaaaaagcagggattcagcaaagatatcaaattgccacgt
actactttccagggctacatcaaggattacgaaggggcaatgcttatgcactgtgagctc
aacgcaaaaatcgtctacaccgagttcacaactgtagtccgaaagcaaaaggagatcgta
aagcaacttatttaccagcgtcagcaggaaatacaaaagattcacccgggactgacttgc
ttcaaggagggtgtacgcggcatacccgtcgaatctataccaggtattcgagagactggg
tggaaaaattatgcgcagacgagaacaaggggtgtcgccaaaggttcacaaggtccagag
cctatggaggcttgtttggatataaatgactcactttacaatgcgcttaagagcgtttta
acgtccattaagaatcacagcgctgcttggccgttcttgaagcctgtcgataaaagcgaa
gtgcctgattattacgatcacatcaagtatcccatggatttgaagacgatgacagatcgg
ctgaagtcgaggtattatgttacacgacgcctctttattgctgacatgacgcgaattttt
acgaattgccgactgtacaatggccctgacacggaatactattcgtgcgccaactcttta
gagaagtatttccagaccaagatgaaggaaattgggctctgggacaaatag

DBGET integrated database retrieval system