KEGG   Nasonia vitripennis (jewel wasp): 100119205Help
Entry
100119205         CDS       T01081                                 

Definition
protein O-mannosyltransferase 1
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    100119205
Enzymes [BR:nvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     100119205
Glycosyltransferases [BR:nvi01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   100119205
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
5
AA seq 784 aa AA seqDB search
MEDRRAGKTKGADVRRVTQEVKDYAKQESSDDDKVQLLKSQNHDKALVANHATSEKKIKT
QFNQTPTSIKVNFDIDLLAVVLLIAGVATRFYRLEEPRSIVFDELHYGKYVSLYMKNTFF
FDPHPPLGKQLISAAAYLAGFDGNFKFDRIGSQYAESAPLFALRLIPALCGSLLIPTAYH
LALEIGLRQWSAAIAGLLLLLDNALLTQSRFILMESILIQFSLVGLLCIMKFRKVRDKPL
TLSWWFWLIAGFGNLTCALCVKYVGFYSLLLALYLVGRDYWSLIPKKHLSTMTLYLHLMA
RIFVIGTVITSVYLSIFYVHLSVLTKAGPHDSVMTSAFQASLEGGLASITKGQPIEVTHG
SQITLRHTHGRACWLHSHDHVYPLRYPDNRGSSHQQQVTCYSFKDVNNWWIVKRPDINDL
VVTKPSEPIKHGDVIQLVHGITSRALNSHDVAAPMTPQSQEVSCYIDYNVSMPAQNLWRL
EIANRDQVGNVWHAIQSQVRLVHVNSEYALKFSGRQLPDWGFNQHEVVADRLIDQSDSIW
NVEEHRYTKSEDQKQRERELLNAEMIPLKATTLSFWEKFIELQAKMLFGGQEVQNTHMYS
SSPLEWPTMTRGIAYWVSTKSNAQVYLLGNIVIWYSGTISVLIYSSLLILYLMRRRRMCF
DIFEEEWDRFVTIGETLFAGYLIHFLPFFFIERTLFLHHYLPAFIFKVLLTAATVDHIYY
LISVHCNSKLALAAYKLFLIGWLALITYVFCKFTALSYGITPLSAKEVLKLRWNEEWDFI
IHKT
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atggaggaccgccgagctggcaagactaaaggcgccgatgttagacgtgtcacccaggag
gtcaaggattacgcgaaacaggaatcgagcgacgatgacaaggttcaattgctcaagagc
cagaaccacgacaaagcactggtggcaaaccatgctaccagtgagaagaaaatcaaaact
cagtttaatcaaaccccaacgagtataaaagtcaattttgacatagatctcttagcagtg
gtgctgttgatagcaggtgttgcaacaagattttaccgtcttgaagaaccaaggagtata
gtgtttgatgaattacactatggcaagtacgtgagtctgtacatgaagaatacattcttt
tttgatccacatccacctcttggcaagcaactcatatccgcagctgcatacttggctgga
ttcgacggaaacttcaagtttgatagaatcggttctcaatatgcagagagtgctcctctt
tttgctcttagactgattcctgctctctgtggaagcttgcttatcccaactgcatatcac
ttagcattagaaataggattaagacaatggagtgctgccattgcaggactattgttgttg
cttgacaatgcacttttgacacaatcaaggttcatcttgatggagagtatcttgatacaa
ttttcactggtgggtttattatgcatcatgaagtttagaaaagttagggataagccattg
acattatcatggtggttctggttaattgcaggatttggaaatttaacatgtgctttatgt
gtcaagtatgttggtttttattcattattgctggctctctacttggttggacgtgattat
tggtcactgattcccaagaagcatctgtcaaccatgactttatacttgcacttaatggca
agaatatttgtgataggaacagttattacttctgtatacttgagcatattttatgtacat
ttatcagtgcttacaaaagcaggacctcatgactccgttatgactagtgcttttcaagca
agtttggaaggtgggctagcaagtatcacaaaaggtcagccaatagaagttacacatggt
tctcaaatcactttgaggcatacacatggtagagcttgttggttgcacagccatgaccat
gtatatccacttagatatcctgacaatcgtggaagttcacaccagcaacaggtcacgtgc
tattcgtttaaagatgtcaataattggtggattgttaagagaccagatatcaatgatctg
gtagtaacaaaacctagtgagcctatcaaacatggagacgtcatacagttggtgcatgga
attacaagtcgtgctctcaattcccatgacgttgcagctcccatgactccccaaagccaa
gaagtttcttgttatattgattacaatgtatctatgccagcacaaaatttgtggagactt
gagattgcaaaccgtgatcaagttggaaacgtttggcatgctattcagtcacaagtacgt
ttagttcacgtgaattcagaatatgctctgaaattcagtggaaggcaattaccagattgg
ggattcaatcagcatgaagtggtagctgacaggctcattgatcaatcagattctatatgg
aatgttgaagagcatcgttacacaaaaagcgaggatcaaaagcagagagaaagagaactg
ctcaatgctgaaatgattccactgaaagctacaaccctgagcttttgggaaaagttcata
gaattacaagcaaaaatgttatttggtggtcaagaggttcaaaatactcacatgtattcc
agtagtcccttagaatggccaaccatgacaagaggtatagcttactgggtttccaccaaa
agcaatgcacaagtttatttgcttggcaacattgtcatttggtattcgggaacgatatcc
gttttaatttactcgtctcttctgattttgtatttaatgcgaagacgaagaatgtgcttt
gacatttttgaagaggagtgggatcgatttgtaactataggggaaactttgtttgcagga
tatctaattcactttttaccgttctttttcattgagcgaacgctatttttacatcactat
ctacctgcgtttattttcaaagtattattgactgcagcaacagtggatcatatttactat
cttataagtgttcactgcaactcaaaattggccttagctgcttataaattatttttgata
ggttggcttgctctaattacttacgtattttgtaaattcactgcactgagctatggaatt
actcctttgtctgcaaaggaggtattaaaattgaggtggaatgaagaatgggactttatt
atccacaagacataa

DBGET integrated database retrieval system