KEGG   Nasonia vitripennis (jewel wasp): 100119223Help
Entry
100119223         CDS       T01081                                 

Gene name
Ppt2
Definition
palmitoyl-protein thioesterase 2 (EC:3.1.2.22)
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100119223 (Ppt2)
  Lipid metabolism
   00062 Fatty acid elongation
    100119223 (Ppt2)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100119223 (Ppt2)
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     100119223 (Ppt2)
Lipid biosynthesis proteins [BR:nvi01004]
 Fatty acid synthase
  Component type
   100119223 (Ppt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
5
AA seq 294 aa AA seqDB search
MSRQHVNFSFLFLALFAIAILPNNVVESYRAVAVIHGVLTGSDSMELITKRIQEMHPGTE
VYNTVRYAGWSSLEPMWRQVEEIGQDILAIGAAFPEGINLLGYSQGGLLARAILQRFPEH
NVKNFISLSSPQAGQYGTKFLHLIFPDLVCETAYELFYSKVGQHTSVGNYWNDPHHQELY
YKYSRFLPFVNNEKITTNTTTFKEGLKKLNKMVLIGGPDDGVITPWQSSQFGFYDKNETV
VELRDRDEYKNDLIGLKTLDKQKKLVMHTVSGIPHFMWHKNVSIVDQFILPHLD
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagacaacacgtcaatttttccttcctttttctcgcgctctttgcgatcgcgata
ctgccaaacaatgttgtggagtcctatcgagccgttgccgtcatccacggggtcctcacc
ggcagcgacagtatggagctcatcaccaagaggatacaggagatgcacccaggaacggaa
gtttataacacggtgaggtacgcaggctggagcagtctggagcccatgtggaggcaagtc
gaggagataggccaggacatattagccataggtgccgcctttcccgagggcataaatctt
ctcggctacagtcagggaggactgctcgccagggctatactgcagaggtttccagagcac
aatgtcaagaatttcatctcgctgagttccccacaagccggtcaatacggaacaaagttt
ctgcatttaatatttcctgatctggtctgcgaaactgcctacgaattgttttactcgaag
gtcggacagcacacgagcgttggaaactattggaatgacccgcatcatcaggaactgtac
tacaaatacagcagatttttaccattcgttaacaacgagaagatcacaacaaataccaca
acgttcaaggaaggcttgaagaagctcaataagatggtgctcataggaggtcccgacgac
ggtgtgatcaccccctggcagagcagtcaatttggtttctacgacaaaaacgaaacggtc
gttgagctacgcgacagggacgagtacaagaacgacttgatcggcttgaaaaccctggat
aaacaaaagaagcttgtgatgcacacagtgtcgggtatcccgcatttcatgtggcacaaa
aacgtgtcaatagtagatcaatttattttaccccacttagattaa

DBGET integrated database retrieval system