KEGG   Nasonia vitripennis (jewel wasp): 100119335Help
Entry
100119335         CDS       T01081                                 

Gene name
RPA2
Definition
(RefSeq) replication protein A2
  KO
K10739  replication factor A2
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi03030  DNA replication
nvi03420  Nucleotide excision repair
nvi03430  Mismatch repair
nvi03440  Homologous recombination
nvi03460  Fanconi anemia pathway
Module
nvi_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100119335 (RPA2)
   03420 Nucleotide excision repair
    100119335 (RPA2)
   03430 Mismatch repair
    100119335 (RPA2)
   03440 Homologous recombination
    100119335 (RPA2)
   03460 Fanconi anemia pathway
    100119335 (RPA2)
DNA replication proteins [BR:nvi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    100119335 (RPA2)
DNA repair and recombination proteins [BR:nvi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     100119335 (RPA2)
   MMR (mismatch exicision repair)
     100119335 (RPA2)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     100119335 (RPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C tRNA_anti-codon RNA_pol_Rpc34 SelB-wing_2
Motif
Other DBs
NCBI-GeneID: 100119335
NCBI-ProteinID: NP_001164370
NASONIABASE: NV13909
Position
1
AA seq 253 aa AA seqDB search
MSWNNFDNSTAGEGGFMNTTVNDSTAGEDKANLKRGQNCVPVMIAHLVRYGEKLTVWGTP
VRLVTFVGLVRKVEPTSTKVSFEFSDDTGNISGLKWLEGDSANYESPVKVNSYARVHGMI
RDQGEDHYVLIVNIQPMDHLMELLSHHMEVTLMSLQGDSMVNKVANNDHSMGNQSVQNGS
VNNSNANSGLNRQQQMVLDIIENSDPEFGAERDQIKSAVAPNVPPQMVDEILEFLFAEGH
IYTTKTDDYFKAI
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggaacaattttgacaattcgacggcaggcgaaggtggcttcatgaacacgacg
gtgaacgattccaccgccggcgaggacaaagccaacctgaaacgcggtcagaactgcgta
cctgtgatgatagcacacctagtgcgctacggcgagaagctcaccgtctggggcactcct
gtcaggctcgtcaccttcgtcggcctcgtccgcaaagtcgagcccaccagcaccaaggtc
tcctttgaattctccgacgacaccgggaacatatcgggactgaagtggttggagggcgat
tcagccaactacgagtctccagtgaaagttaattcatacgccagggtgcatgggatgatc
agggaccagggtgaagatcactacgtccttattgtcaatatccagcctatggaccatctc
atggaactgttgtcacatcatatggaggtgacacttatgagtcttcagggagatagtatg
gttaacaaagtagccaacaatgaccactctatgggcaatcagtcagtgcaaaatggatcg
gttaacaatagtaacgcaaactctggtctcaatcgacaacaacagatggtactggatatc
attgagaatagtgatccagagtttggggctgagagggatcagattaagagtgcagtggct
ccaaatgttcctcctcaaatggtggatgagattttggaatttctgtttgctgaaggccat
atttatacaacaaagacagatgattatttcaaggctatttaa

DBGET integrated database retrieval system