KEGG   Nasonia vitripennis (jewel wasp): 100119335Help
Entry
100119335         CDS       T01081                                 

Gene name
RPA2
Definition
(RefSeq) replication protein A2
  KO
K10739  
replication factor A2
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100119335 (RPA2)
   03420 Nucleotide excision repair
    100119335 (RPA2)
   03430 Mismatch repair
    100119335 (RPA2)
   03440 Homologous recombination
    100119335 (RPA2)
   03460 Fanconi anemia pathway
    100119335 (RPA2)
DNA replication proteins [BR:nvi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    100119335 (RPA2)
DNA repair and recombination proteins [BR:nvi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     100119335 (RPA2)
   MMR (mismatch exicision repair)
     100119335 (RPA2)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     100119335 (RPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
NASONIABASE: 
Position
1
AA seq 253 aa AA seqDB search
MSWNNFDNSTAGEGGFMNTTVNDSTAGEDKANLKRGQNCVPVMIAHLVRYGEKLTVWGTP
VRLVTFVGLVRKVEPTSTKVSFEFSDDTGNISGLKWLEGDSANYESPVKVNSYARVHGMI
RDQGEDHYVLIVNIQPMDHLMELLSHHMEVTLMSLQGDSMVNKVANNDHSMGNQSVQNGS
VNNSNANSGLNRQQQMVLDIIENSDPEFGAERDQIKSAVAPNVPPQMVDEILEFLFAEGH
IYTTKTDDYFKAI
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggaacaattttgacaattcgacggcaggcgaaggtggcttcatgaacacgacg
gtgaacgattccaccgccggcgaggacaaagccaacctgaaacgcggtcagaactgcgta
cctgtgatgatagcacacctagtgcgctacggcgagaagctcaccgtctggggcactcct
gtcaggctcgtcaccttcgtcggcctcgtccgcaaagtcgagcccaccagcaccaaggtc
tcctttgaattctccgacgacaccgggaacatatcgggactgaagtggttggagggcgat
tcagccaactacgagtctccagtgaaagttaattcatacgccagggtgcatgggatgatc
agggaccagggtgaagatcactacgtccttattgtcaatatccagcctatggaccatctc
atggaactgttgtcacatcatatggaggtgacacttatgagtcttcagggagatagtatg
gttaacaaagtagccaacaatgaccactctatgggcaatcagtcagtgcaaaatggatcg
gttaacaatagtaacgcaaactctggtctcaatcgacaacaacagatggtactggatatc
attgagaatagtgatccagagtttggggctgagagggatcagattaagagtgcagtggct
ccaaatgttcctcctcaaatggtggatgagattttggaatttctgtttgctgaaggccat
atttatacaacaaagacagatgattatttcaaggctatttaa

DBGET integrated database retrieval system