KEGG   Nasonia vitripennis (jewel wasp): 100119344Help
Entry
100119344         CDS       T01081                                 

Definition
putative glycerol kinase 3-like
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100119344
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     100119344
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100119344
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
2
AA seq 553 aa AA seqDB search
MTENAKTTSSANRYGPLIGAIDEGTSSVRFLVFAANTAEVLTYHQKELKVSYPQEGWVEQ
DPMEILEAVHECLNQTVENLKQLTINPADIVAIGITNQRETTIVWDTKTGKPLYNAIVWM
DMRTTSIIDELLKKVRNQNKNYLKSLCGLPISPYFSALKMKWLMDNVSEVQEAIKENRCM
FGTVDSWLIWNLTGGSNGGVHCTDVTNASRTMLMNIVNLKWDPYLLSFFQIPEDILPQIR
SSSEIYGNIVDGVLQGVPISGCLGDQQAALVGQMCFQHGQAKSTYGTGCFLLYNTGTKIV
DSAHGLLTTVGYQFGPKADPVYALEGSIAMAGAIVKWLKDNLQVIDDVSETEAIAEKLTC
DNRIIFVPAFSGLYAPYWRKDARSVICGITEDINYRHIVKAALQSVCFQTRDILEAMRED
TGMTLTKLLVDGAMTSNNLLMQMQADICGVPVVRPVMCEITALGVAIAAGCAEGIKKWDI
TVGTNVPSDTFTPSITENERDMLYSEWKKGIERSLDWETDAASEEEEDINKMTASGLFVF
GTLLLLMFARYRS
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaatgcaaagacgacgagcagtgcaaacagatatggcccgctcatcggagct
atcgacgagggcacgagcagcgtcagatttttggtctttgcagccaatactgccgaggtc
ttaacgtatcatcaaaaagagctcaaagtctcttatccacaagaaggatgggtggaacaa
gacccgatggaaatactcgaagcagttcacgaatgtttgaatcagactgtagaaaattta
aaacaactaacaattaatccagctgacattgttgctattggaattacaaatcaaagagaa
acgacgatagtctgggataccaagactggaaaaccattatacaatgctattgtgtggatg
gatatgcgaactacctctatcatagatgaacttcttaagaaagtccgtaatcagaataaa
aattatctcaaatcactctgtggtttaccaataagcccctattttagtgctctgaaaatg
aagtggcttatggacaacgtaagcgaggtccaagaagctatcaaagaaaatagatgtatg
tttgggactgttgattcatggctcatatggaatttaacaggtggctcaaatggtggggtt
cattgtacagatgtaactaatgcttccagaactatgttaatgaacattgtaaatttaaaa
tgggatccatatcttttatctttcttccaaatcccagaagatattctgccacaaatccgt
agctcttcagagatttacggcaatatcgttgatggtgttttacagggggttccaatatct
ggttgtttaggagatcaacaagctgctcttgttggtcaaatgtgcttccaacatggccaa
gccaaaagtacttatggaactggatgtttccttttatacaatacaggaacgaagattgtt
gattcagcccatggtttgttgacaacagttggatatcaatttggtccaaaggctgatcca
gtctatgccttagaaggttcgattgctatggctggtgctattgttaaatggttaaaagac
aatctacaagttattgacgacgtatctgaaacagaagctattgctgagaaactcacatgt
gataatcgaattatttttgttcctgcgttttctggactgtatgcgccttattggcgaaaa
gatgccagaagtgtgatttgcggtattacggaggacatcaattatcgacacatagtgaaa
gctgcacttcaatctgtctgtttccaaactagagatattttggaagctatgagagaagat
acaggaatgaccttgacaaaattattagttgatggagctatgactagtaataatctactt
atgcaaatgcaagcggatatctgtggtgttccagtagttcgaccagtaatgtgtgaaata
acagcacttggagtagcaattgcagctggctgcgcagaaggtataaaaaagtgggatata
actgttggtaccaatgtcccaagtgatacttttactccgtcaattacagaaaatgaacga
gatatgttatattcagagtggaagaagggcattgaacgaagtctcgattgggaaactgat
gctgcttctgaggaagaggaggacatcaataagatgacagcatccggtttgtttgtgttt
ggcactttactactacttatgttcgcgaggtatcgatcgtga

DBGET integrated database retrieval system