KEGG   Nasonia vitripennis (jewel wasp): 100119366Help
Entry
100119366         CDS       T01081                                 

Definition
6-phosphogluconolactonase-like
Orthology
K01057  
6-phosphogluconolactonase [EC:3.1.1.31]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Pentose phosphate pathway
Metabolic pathways
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100119366
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100119366
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     100119366
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
1
AA seq 236 aa AA seqDB search
MSAEILIEPDATGVVQRLALIVEKCANEAIDNEDIFKIGLSGGSLVKFLSEGLPTINTDW
SKWRFFFCDERIVSFENGESTYGLYRESLIGNLPITEDQFIKINPDLSAEEAAKDYIKKM
SVYFPPDSVPRFDVLLLGMGPDGHTCSLFPNHRLLDETSLWVCPINDSPKPPSSRITLTF
PVINNARACIFAATGASKKEMVKRILKDKENLPAARVQPTNGTLYWILDKDAAGGL
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcggagattctcatcgagccggacgcgaccggcgtcgtccagaggctggcgctc
atcgtcgagaagtgcgcgaacgaagccatcgacaacgaggatatcttcaaaattggcctg
tccggtggatcgctagtgaagttcctgtctgagggtcttcctactatcaacactgactgg
agcaagtggagattcttcttctgcgacgagaggattgtatcctttgagaatggagagtca
acgtatggactttacagggagagcttgatcgggaatcttcctattactgaagatcagttc
ataaaaatcaatcctgacctttcagctgaggaagcagctaaagactacatcaagaaaatg
tcagtgtatttccctcctgacagtgtgccgagatttgatgttctgctacttggaatggga
ccagatggtcatacctgctcattgtttcctaatcatcggttattagatgaaaccagtttg
tgggtgtgcccaataaacgactctcccaagccaccatcatccaggatcaccttgaccttc
ccagtgatcaacaatgcaagggcatgcatttttgctgcaactggagcaagcaaaaaagaa
atggtcaaacgcatattgaaagacaaagagaacttacctgctgccagagtacagccaaca
aatggcactctgtactggattttggacaaagatgctgctggaggcttatag

DBGET integrated database retrieval system