KEGG   Nasonia vitripennis (jewel wasp): 100119366Help
Entry
100119366         CDS       T01081                                 

Definition
6-phosphogluconolactonase-like
Orthology
K01057  
6-phosphogluconolactonase [EC:3.1.1.31]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Pentose phosphate pathway
Metabolic pathways
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:nvi01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:nvi00030]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
1
AA seq 236 aa AA seqDB search
MSAEILIEPDATGVVQRLALIVEKCANEAIDNEDIFKIGLSGGSLVKFLSEGLPTINTDW
SKWRFFFCDERIVSFENGESTYGLYRESLIGNLPITEDQFIKINPDLSAEEAAKDYIKKM
SVYFPPDSVPRFDVLLLGMGPDGHTCSLFPNHRLLDETSLWVCPINDSPKPPSSRITLTF
PVINNARACIFAATGASKKEMVKRILKDKENLPAARVQPTNGTLYWILDKDAAGGL
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcggagattctcatcgagccggacgcgaccggcgtcgtccagaggctggcgctc
atcgtcgagaagtgcgcgaacgaagccatcgacaacgaggatatcttcaaaattggcctg
tccggtggatcgctagtgaagttcctgtctgagggtcttcctactatcaacactgactgg
agcaagtggagattcttcttctgcgacgagaggattgtatcctttgagaatggagagtca
acgtatggactttacagggagagcttgatcgggaatcttcctattactgaagatcagttc
ataaaaatcaatcctgacctttcagctgaggaagcagctaaagactacatcaagaaaatg
tcagtgtatttccctcctgacagtgtgccgagatttgatgttctgctacttggaatggga
ccagatggtcatacctgctcattgtttcctaatcatcggttattagatgaaaccagtttg
tgggtgtgcccaataaacgactctcccaagccaccatcatccaggatcaccttgaccttc
ccagtgatcaacaatgcaagggcatgcatttttgctgcaactggagcaagcaaaaaagaa
atggtcaaacgcatattgaaagacaaagagaacttacctgctgccagagtacagccaaca
aatggcactctgtactggattttggacaaagatgctgctggaggcttatag

DBGET integrated database retrieval system