KEGG   Nasonia vitripennis (jewel wasp): 100119366Help
Entry
100119366         CDS       T01081                                 

Definition
(RefSeq) 6-phosphogluconolactonase
  KO
K01057  
6-phosphogluconolactonase [EC:3.1.1.31]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100119366
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100119366
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     100119366
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
1
AA seq 236 aa AA seqDB search
MSAEILIEPDATGVVQRLALIVEKCANEAIDNEDIFKIGLSGGSLVKFLSEGLPTINTDW
SKWRFFFCDERIVSFENGESTYGLYRESLIGNLPITEDQFIKINPDLSAEEAAKDYIKKM
SVYFPPDSVPRFDVLLLGMGPDGHTCSLFPNHRLLDETSLWVCPINDSPKPPSSRITLTF
PVINNARACIFAATGASKKEMVKRILKDKENLPAARVQPTNGTLYWILDKDAAGGL
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcggagattctcatcgagccggacgcgaccggcgtcgtccagaggctggcgctc
atcgtcgagaagtgcgcgaacgaagccatcgacaacgaggatatcttcaaaattggcctg
tccggtggatcgctagtgaagttcctgtctgagggtcttcctactatcaacactgactgg
agcaagtggagattcttcttctgcgacgagaggattgtatcctttgagaatggagagtca
acgtatggactttacagggagagcttgatcgggaatcttcctattactgaagatcagttc
ataaaaatcaatcctgacctttcagctgaggaagcagctaaagactacatcaagaaaatg
tcagtgtatttccctcctgacagtgtgccgagatttgatgttctgctacttggaatggga
ccagatggtcatacctgctcattgtttcctaatcatcggttattagatgaaaccagtttg
tgggtgtgcccaataaacgactctcccaagccaccatcatccaggatcaccttgaccttc
ccagtgatcaacaatgcaagggcatgcatttttgctgcaactggagcaagcaaaaaagaa
atggtcaaacgcatattgaaagacaaagagaacttacctgctgccagagtacagccaaca
aatggcactctgtactggattttggacaaagatgctgctggaggcttatag

DBGET integrated database retrieval system